BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120535.Seq (670 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC104924-1|AAI04925.1| 333|Homo sapiens G protein-coupled recep... 31 4.9 BC104922-1|AAI04923.1| 333|Homo sapiens putative purinergic rec... 31 4.9 AY242133-1|AAO92300.1| 333|Homo sapiens putative purinergic rec... 31 4.9 AL590222-1|CAD13458.1| 333|Homo sapiens G protein-coupled recep... 31 4.9 AB083599-1|BAB89312.1| 333|Homo sapiens putative G-protein coup... 31 4.9 >BC104924-1|AAI04925.1| 333|Homo sapiens G protein-coupled receptor 174 protein. Length = 333 Score = 30.7 bits (66), Expect = 4.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -2 Query: 354 INLVISSVY*TLSRLLTTPFFVNSTLIFSSRLDIFCHFLQLRPTFESCYFASC 196 INL I+ + LS L +++N F L +FC +L+ + S YF C Sbjct: 59 INLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVC 111 >BC104922-1|AAI04923.1| 333|Homo sapiens putative purinergic receptor FKSG79 protein. Length = 333 Score = 30.7 bits (66), Expect = 4.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -2 Query: 354 INLVISSVY*TLSRLLTTPFFVNSTLIFSSRLDIFCHFLQLRPTFESCYFASC 196 INL I+ + LS L +++N F L +FC +L+ + S YF C Sbjct: 59 INLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVC 111 >AY242133-1|AAO92300.1| 333|Homo sapiens putative purinergic receptor protein. Length = 333 Score = 30.7 bits (66), Expect = 4.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -2 Query: 354 INLVISSVY*TLSRLLTTPFFVNSTLIFSSRLDIFCHFLQLRPTFESCYFASC 196 INL I+ + LS L +++N F L +FC +L+ + S YF C Sbjct: 59 INLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVC 111 >AL590222-1|CAD13458.1| 333|Homo sapiens G protein-coupled receptor 174 protein. Length = 333 Score = 30.7 bits (66), Expect = 4.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -2 Query: 354 INLVISSVY*TLSRLLTTPFFVNSTLIFSSRLDIFCHFLQLRPTFESCYFASC 196 INL I+ + LS L +++N F L +FC +L+ + S YF C Sbjct: 59 INLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVC 111 >AB083599-1|BAB89312.1| 333|Homo sapiens putative G-protein coupled receptor protein. Length = 333 Score = 30.7 bits (66), Expect = 4.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -2 Query: 354 INLVISSVY*TLSRLLTTPFFVNSTLIFSSRLDIFCHFLQLRPTFESCYFASC 196 INL I+ + LS L +++N F L +FC +L+ + S YF C Sbjct: 59 INLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVC 111 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,067,501 Number of Sequences: 237096 Number of extensions: 1712732 Number of successful extensions: 11242 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11242 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -