BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120534.Seq (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 6.3 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 8.4 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 6.3 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 143 CCLKKQPPPVLYRLLTILPVLFYCNFLINFTL---KITHRLSAFFPS 274 C + P +LYR + LF LI+FTL + + L+ PS Sbjct: 481 CLVNSNPSAILYRA-SRSKSLFMSTLLISFTLALVPVVYALAEIVPS 526 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = -2 Query: 201 TGKIVNSLYKTGGGCFFKQ---HILVDVV 124 TG+ V LY GC +Q H+L++++ Sbjct: 601 TGRFVKELYDVRSGCVQEQDGTHLLMNLI 629 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,944 Number of Sequences: 2352 Number of extensions: 10907 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -