BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120534.Seq (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69661-3|CAA93490.1| 293|Caenorhabditis elegans Hypothetical pr... 31 0.71 Z49912-1|CAA90140.1| 588|Caenorhabditis elegans Hypothetical pr... 28 6.6 >Z69661-3|CAA93490.1| 293|Caenorhabditis elegans Hypothetical protein F48F7.5 protein. Length = 293 Score = 31.1 bits (67), Expect = 0.71 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = -2 Query: 252 RCVIFNVKFIKKLQ*NRTGKIVNSLYKTGG--GCFFKQHILVDVVVKIKF--LFRPVCS* 85 RC FN +F K N TG + N+L + G F+Q++L + ++KIK L +P Sbjct: 112 RCRRFNYQFSKFA--NHTGALFNNLMHSNEQLGTLFQQYVLDEHIIKIKTGRLSKPATEE 169 Query: 84 MADIKS 67 + +I+S Sbjct: 170 VPNIES 175 >Z49912-1|CAA90140.1| 588|Caenorhabditis elegans Hypothetical protein T24F1.2 protein. Length = 588 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 182 LLTILPVLFYCNFLINFTLKITHRLSAF 265 L ILP ++ +F+INF + TH ++AF Sbjct: 248 LQDILPEVYKYSFVINFLIFTTHLIAAF 275 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,064,355 Number of Sequences: 27780 Number of extensions: 246824 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -