BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120527.Seq (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) ide... 29 4.6 At5g36920.1 68418.m04425 expressed protein predicted protein, Ar... 28 6.1 At4g36010.1 68417.m05127 pathogenesis-related thaumatin family p... 28 6.1 At3g19300.1 68416.m02448 protein kinase family protein contains ... 28 6.1 At2g17860.1 68415.m02069 pathogenesis-related thaumatin family p... 28 6.1 At2g04080.1 68415.m00391 MATE efflux family protein similar to h... 28 8.1 >At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) identical to like heterochromatin protein LHP1 [Arabidopsis thaliana] GI:15625407; contains Pfam profile PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 445 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 412 IKQPEWPSSPAMWDLVKNTPELADFVFIFDHTERWVKKWPTDRHRRLQATTQQFQRAKKD 591 IK WP + W+ ++N +AD + D E +K R R+ + Q KK Sbjct: 127 IKWRGWPETANTWEPLENLQSIAD---VIDAFEGSLKPGKPGRKRKRKYAGPHSQMKKKQ 183 Query: 592 RL 597 RL Sbjct: 184 RL 185 >At5g36920.1 68418.m04425 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 82 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 628 NSAKFALVSTAVCLFLLAGIAALSLEDDDVDRSAIFLP 515 N++ L+S +CL + G+ S+ DDD+ AI+ P Sbjct: 5 NTSHVLLLSLLLCLMFVIGLVEASIPDDDMG-PAIYTP 41 >At4g36010.1 68417.m05127 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family Length = 301 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -3 Query: 174 EDCCSGMFTMFDFCKPLKRPACILDDIFF*CPTAWQFVCDEDT 46 E CCSG F D CKP + + CP A+ + D+ T Sbjct: 196 EYCCSGAFGTPDTCKPSEYSQFFKNA----CPRAYSYAYDDGT 234 >At3g19300.1 68416.m02448 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 663 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 226 IELLQQIQHGQLIAIVNFLEKKNINYIL 309 IELL ++ H L+A+ F KKN +++ Sbjct: 371 IELLARLHHRHLVALKGFCNKKNERFLV 398 >At2g17860.1 68415.m02069 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family Length = 253 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 174 EDCCSGMFTMFDFCKPLKRPACILDDIFF--*CPTAWQFVCDEDT 46 E CC+G F D C+P + +FF CPTA+ + D+ T Sbjct: 195 EFCCNGAFGTPDTCQPSEY------SVFFKKTCPTAYSYAYDDGT 233 >At2g04080.1 68415.m00391 MATE efflux family protein similar to hypothetical protein GB:AAC27412; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 476 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 371 TTINTFCLTVGTLRSSSPSGLVA 439 T++ + CLT+GTL PSG+ A Sbjct: 287 TSVLSICLTIGTLHYVIPSGVAA 309 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,895,979 Number of Sequences: 28952 Number of extensions: 359992 Number of successful extensions: 950 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -