BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120525X.Seq (536 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 27 0.10 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 9.1 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 27.1 bits (57), Expect = 0.10 Identities = 18/74 (24%), Positives = 31/74 (41%) Frame = -3 Query: 261 QKFEKMFFTLCMLSVLLA*FSKLLFMETIHLLNSVKKVRPLPSTIKLWLKYFENKKHNES 82 Q+ E+ FT L +L F+K + + K+ S +++W K K + Sbjct: 127 QRRERTTFTRAQLDLLEGLFAKTRYPDIFMREEVAVKINLPESRVQVWFKNRRAKCRQQL 186 Query: 81 ISSRNNCASKHTFS 40 +N AS+ T S Sbjct: 187 QQQQNKSASRTTTS 200 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 9.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 364 CQSCKPANKIQCF 402 C SC P QCF Sbjct: 45 CVSCGPGQSGQCF 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,882 Number of Sequences: 336 Number of extensions: 3176 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -