BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120524.Seq (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.3 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 21 9.1 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 21 9.1 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 21 9.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -3 Query: 712 NKSFSYSGTSIPWNIFSNDNLIRFSVGSISCLINNRLTFMATFMSLHNKC 563 ++ + YS + N F +D+ F VG +CL F+A++ + N+C Sbjct: 1587 SEDYRYSVRGLCGN-FDHDSTNDF-VGPKNCLFRKPEHFVASYALISNQC 1634 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 603 RRLLIKHEMLPTEKRIRLSFE 665 RR+ I H + TE++I++ F+ Sbjct: 37 RRIEIAHALCLTERQIKIWFQ 57 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 603 RRLLIKHEMLPTEKRIRLSFE 665 RR+ I H + TE++I++ F+ Sbjct: 37 RRIEIAHALCLTERQIKIWFQ 57 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 603 RRLLIKHEMLPTEKRIRLSFE 665 RR+ I H + TE++I++ F+ Sbjct: 37 RRIEIAHALCLTERQIKIWFQ 57 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 603 RRLLIKHEMLPTEKRIRLSFE 665 RR+ I H + TE++I++ F+ Sbjct: 299 RRIEIAHALCLTERQIKIWFQ 319 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,290 Number of Sequences: 438 Number of extensions: 4580 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -