BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120523.Seq (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39175| Best HMM Match : DUF1378 (HMM E-Value=8) 33 0.32 SB_15223| Best HMM Match : ASC (HMM E-Value=1.8e-19) 28 6.8 SB_15221| Best HMM Match : ASC (HMM E-Value=0.0016) 28 6.8 >SB_39175| Best HMM Match : DUF1378 (HMM E-Value=8) Length = 282 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +3 Query: 555 KRAVEHRRVDKFYNARGSQIRKTQF*ITTLP*RLSTRRETRASSSQRQSAHP 710 KR RR+D A S+ K ITT+P RL+ RRE +S + SAHP Sbjct: 123 KRLPFRRRLD----AINSEKSKASQGITTIPSRLTYRREDNTRASSQCSAHP 170 >SB_15223| Best HMM Match : ASC (HMM E-Value=1.8e-19) Length = 605 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 487 KNRRAYAMAIWPQIFPLLCDE---HQNVQLNTDVLINFIMHVARKFAKH 624 K +R + I + FP D+ H NV+ NT + + ++ + +K +KH Sbjct: 508 KEKREASWHIDEEAFPCYRDQATIHPNVESNTSLTVRYLDDIVQKKSKH 556 >SB_15221| Best HMM Match : ASC (HMM E-Value=0.0016) Length = 490 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 487 KNRRAYAMAIWPQIFPLLCDE---HQNVQLNTDVLINFIMHVARKFAKH 624 K +R + I + FP D+ H NV+ NT + + ++ + +K +KH Sbjct: 393 KEKREASWHIDEEAFPCYRDQATIHPNVESNTSLTVRYLDDIVQKKSKH 441 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,160,347 Number of Sequences: 59808 Number of extensions: 430986 Number of successful extensions: 1075 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -