BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120523.Seq (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 25 0.56 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 3.0 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 22 5.2 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 6.8 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 22 6.8 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 85 GHWQQHVANTKKPPQQTAGKPFGANANGGRRHVANHQHHGLS 210 GHWQ PP+QT P +G RR +++ +S Sbjct: 383 GHWQMSCVACSPPPRQT---PPSRKESGRRRRRRTPRYNSVS 421 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 363 VDRFDSIQLNFGLVGLHRFQQIARSDRLSRQN 268 +DR D++ + + R +I R DR+ R N Sbjct: 498 MDRMDTMDRTDKMSRIDRMDKIDRMDRMDRTN 529 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 247 Q*NESLKILSTQSVGARNLLEPMQANETKIKLNRI 351 Q N+SLK+ LL + N++ +K R+ Sbjct: 97 QVNDSLKVTRLYEFSDNELLVHISTNKSDVKATRV 131 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 178 HVANHQHHGLSNGRVVVNQRHYAQ*NESLK 267 H+A H + L +G + + RH++Q E L+ Sbjct: 133 HLAMHDYPPLVSGALHLLFRHFSQRQEVLQ 162 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 178 HVANHQHHGLSNGRVVVNQRHYAQ*NESLK 267 H+A H + L +G + + RH++Q E L+ Sbjct: 101 HLAMHDYPPLVSGALHLLFRHFSQRQEVLQ 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,396 Number of Sequences: 438 Number of extensions: 3807 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -