BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120522.Seq (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 25 1.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.5 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 7.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 7.2 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 7.2 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 25.4 bits (53), Expect = 1.8 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Frame = +3 Query: 186 KGAMRRAFGRVCNN*R*TFG------NVQYRIENKFFYYYDQCADI-AKPDRLPDDDGAC 344 KG F V NN + +G N QY +N F YYD AD+ A+ RLP Sbjct: 198 KGLWTYPFPEVANNVKPFYGTRGKPTNAQYMEQNGQF-YYDNSADLGAQILRLPYRGNKL 256 Query: 345 CHHFI 359 +FI Sbjct: 257 AMYFI 261 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 28 SHVLNVQENIMTSNCASSPYSCEAT 102 S + VQ+NI S CASS C +T Sbjct: 3337 SGIGQVQQNIAASCCASSTIRCLST 3361 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 687 KKIFHP*IFLYKHCIRTKPNC 625 KK + + YK +RT PNC Sbjct: 175 KKDYRGALAFYKKALRTNPNC 195 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 150 LSHVHRRHTNRRKGAMRR 203 L HVH T RR+G RR Sbjct: 137 LEHVHSGATPRRRGLTRR 154 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 150 LSHVHRRHTNRRKGAMRR 203 L HVH T RR+G RR Sbjct: 137 LEHVHSGATPRRRGLTRR 154 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 150 LSHVHRRHTNRRKGAMRR 203 L HVH T RR+G RR Sbjct: 23 LEHVHSGATPRRRGLTRR 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,380 Number of Sequences: 2352 Number of extensions: 15243 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -