BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120522.Seq (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.7 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.9 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 2.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.7 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -2 Query: 264 LFYIVH---FQMFIVNYCKRGRTHAALHLCVDLYVGGVHVKENKVINHYLLSFCASGRCL 94 +FYI+ F+ + +YC TH + + V +V+E+ + LL+F CL Sbjct: 345 VFYIISRYVFRSALEDYCNIVATHLVCGILGSILVPFFYVQEDDDVKLVLLNFGWQMICL 404 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 563 LFIEKLETINKTVKSYEFVRRQFGF 637 +F EK+ET + K + + R FGF Sbjct: 576 IFYEKIETSLNSDKPFTYNERIFGF 600 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 250 YNIE*RINFFITMINVPT 303 YN+E ++N+FI I + T Sbjct: 214 YNLENKLNYFIEDIGLNT 231 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 563 LFIEKLETINKTVKSYEFVRRQFGF 637 +F EK+ET + K + + R FGF Sbjct: 576 IFYEKIETSLNSDKPFTYNERIFGF 600 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -1 Query: 676 SSVDISLQTLHSYKTELSTNKFITFNSFINSFQ 578 + +D++++TL + + N F+T S + F+ Sbjct: 660 TEIDVAIKTLKPGSADKARNDFLTEASIMGQFE 692 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 282 YYDQCADIAKPDRLPDDDGACCHHFIFDAQR 374 +Y++ A +PDR D G +FD R Sbjct: 246 HYERRATPPQPDRTSKDQGTIGESEVFDTTR 276 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,372 Number of Sequences: 438 Number of extensions: 4057 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -