BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120520X.Seq (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51040| Best HMM Match : Kinesin (HMM E-Value=5.89947e-43) 31 0.84 SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 >SB_51040| Best HMM Match : Kinesin (HMM E-Value=5.89947e-43) Length = 197 Score = 30.7 bits (66), Expect = 0.84 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 221 AHFRRRRQSIQMTIAR-HLVGNKERGIKRILIPSATNYQEVFN-LNSMMQAEQLIFHLIY 394 AHF R S+ + + +L GN + + + PSA NY+E + L +A++++ H + Sbjct: 131 AHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKIVNHAVV 190 Query: 395 NNE 403 N + Sbjct: 191 NED 193 >SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1203 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = +3 Query: 144 DAYHD-DGWFICNSHLIKRFKMSKMVLP--IFDEDDNQFK*RSLGI*LEIKKE 293 DA D GW++ L+K+F+ S+M + D+D ++ + + + L++ KE Sbjct: 186 DASSDFKGWYLLKKQLLKKFENSRMATKKLVSDDDGTPYR-KKMKLSLKVNKE 237 >SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 440 TAVSQAARNGYTQRLRNYKKHSRTTNPNT 526 T S+ +R Y QR R YK HS P T Sbjct: 282 TVGSKCSRGTYIQRYRFYKSHSAPVPPET 310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,897,334 Number of Sequences: 59808 Number of extensions: 344327 Number of successful extensions: 791 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -