BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120520X.Seq (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ... 30 1.2 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 30 1.2 At2g32910.1 68415.m04035 expressed protein 29 2.1 At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept... 29 2.8 At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00... 27 6.4 At2g39180.1 68415.m04812 protein kinase family protein contains ... 27 8.5 >At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 361 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 302 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 424 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 302 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 424 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At2g32910.1 68415.m04035 expressed protein Length = 691 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 144 DAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDD 242 D+Y D ++IC H ++R + MV P +DD Sbjct: 610 DSYRRDPYYICERHALERPPRTYMVSPGRQDDD 642 >At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 694 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 121 HTSHRVRPTRIMTTDGLSATATSSNVLKCQKWF-CPFSTKTTINSNDDR 264 H+S P+R+ + +T S KC+K F +T T+++ +D+ Sbjct: 415 HSSESPLPSRVTRSKARKSTLESGEPAKCEKTFEAKINTHKTLDNREDK 463 >At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00646 F-box domain Length = 338 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 377 IFHLIYNNEEAVNVICDNLKYTAVSQAARNGYT 475 IF +Y EE V+C N+K + ++AR YT Sbjct: 298 IFSSLYFEEEKKVVLCCNVKLLMMIRSARTWYT 330 >At2g39180.1 68415.m04812 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 776 Score = 27.1 bits (57), Expect = 8.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 135 CSPDAYHDDGWFICNSHLIKRFKMSKM 215 CSP DGWF N+ ++K +++ + Sbjct: 336 CSPRGNCGDGWFAFNASILKESELTSL 362 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,064,483 Number of Sequences: 28952 Number of extensions: 229153 Number of successful extensions: 504 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -