BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120518.Seq (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 113 8e-26 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 107 9e-24 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 79 3e-15 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 49 2e-06 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 48 7e-06 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 43 2e-04 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 2e-04 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 42 4e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 41 6e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 41 6e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 41 9e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 9e-04 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 41 9e-04 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.005 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 38 0.005 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 38 0.006 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.008 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 38 0.008 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 37 0.014 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 36 0.018 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.024 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.042 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.042 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 35 0.056 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 35 0.056 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 34 0.074 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 34 0.098 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 34 0.098 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 34 0.098 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 33 0.17 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.23 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 33 0.23 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.23 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 31 0.52 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 31 0.52 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 0.91 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 0.91 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.6 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 2.1 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 29 2.1 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 29 2.1 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 2.1 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 29 2.8 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 3.7 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 29 3.7 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 28 4.9 At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containi... 28 4.9 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 4.9 At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containi... 28 4.9 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 6.4 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 28 6.4 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 28 6.4 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 28 6.4 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.5 At1g12700.1 68414.m01473 helicase domain-containing protein / pe... 27 8.5 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 113 bits (273), Expect = 8e-26 Identities = 49/121 (40%), Positives = 71/121 (58%) Frame = +3 Query: 258 VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT +GYS QG CKFGFYE Sbjct: 96 VTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQGACKFGFYE 155 Query: 438 VFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSPCRPWRRLRSVSKTMPGFASTLRE 617 FK Y+ + E Y+T +Y P+ ++ +T PGFA + + Sbjct: 156 YFKKTYSDLAGPEYTAKYKTLIYLAGSASAEIIADIALCPFEAVKVRVQTQPGFARGMSD 215 Query: 618 G 620 G Sbjct: 216 G 216 Score = 34.7 bits (76), Expect = 0.056 Identities = 22/77 (28%), Positives = 33/77 (42%) Frame = +1 Query: 37 MFSSLLDAARNSPFRGPLSPAQCQSTVAPVAIEQTGGMAASAAVPTESCEFGSPKYFAXX 216 + +L++ N+ F SPA S + I + + AS P + E SP ++A Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 217 XXXXXXSCGLTHTPWCP 267 SCGLTH P Sbjct: 82 TFGGILSCGLTHMTVTP 98 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 107 bits (256), Expect = 9e-24 Identities = 45/123 (36%), Positives = 72/123 (58%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 A+ PLD++KC +Q+D KYKN+ + FK +++E+G++G +GW+PT +GYS QG K+G Y Sbjct: 84 AITPLDVIKCNMQIDPLKYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLY 143 Query: 435 EVFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSPCRPWRRLRSVSKTMPGFASTLR 614 E K Y+ ++ E A Y+T +Y P ++ +T PGFA L Sbjct: 144 EYAKKYYSDIVGPEYAAKYKTLIYLAGSASAEIVADVALCPMEAVKVRVQTQPGFARGLS 203 Query: 615 EGV 623 +G+ Sbjct: 204 DGL 206 Score = 37.1 bits (82), Expect = 0.010 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 139 TGGMAASAAVPTESCEFGSPKYFAXXXXXXXXSCGLTHTPWCP 267 + G + + A P E E SP YFA SCG+THT P Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITP 87 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 78.6 bits (185), Expect = 3e-15 Identities = 40/122 (32%), Positives = 63/122 (51%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 A+ PLD++K +QV+ KY ++ +GF +RE G L +GW+ +GY +QG C+FG Y Sbjct: 35 AITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHSYLWRGWSGKLLGYGVQGGCRFGLY 94 Query: 435 EVFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSPCRPWRRLRSVSKTMPGFASTLR 614 E FK Y+ +L + RT +Y P+ ++ +T P FA L Sbjct: 95 EYFKTLYSDVLPNHN----RTSIYFLSSASAQIFADMALCPFEAIKVRVQTQPMFAKGLL 150 Query: 615 EG 620 +G Sbjct: 151 DG 152 Score = 30.7 bits (66), Expect = 0.91 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 386 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 49.2 bits (112), Expect = 2e-06 Identities = 29/101 (28%), Positives = 43/101 (42%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 443 PL+LVK RL + YK + + F +REEG L +G AP+ IG + Y+ Sbjct: 224 PLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSL 283 Query: 444 KVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSPCRPWRR 566 + AY E T + +S+ T P R+ Sbjct: 284 RKAYRSFSKQEKIGNIETLLIGSLAGALSSTATFPLEVARK 324 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 422 A PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 315 ATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGIS 374 Query: 423 FGFYEVFK 446 F YE K Sbjct: 375 FMCYEACK 382 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 47.6 bits (108), Expect = 7e-06 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 428 A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G F Sbjct: 193 ATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISFA 252 Query: 429 FYEVFK 446 YE FK Sbjct: 253 AYETFK 258 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +3 Query: 255 AVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 392 A PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 288 ATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = +3 Query: 264 PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFG 428 P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G + + FG Sbjct: 34 PFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGMAFESSLMFG 93 Query: 429 FYEVFKVAYAGMLDDE 476 Y K+ G L D+ Sbjct: 94 IYSQAKLFLRGTLPDD 109 Score = 30.7 bits (66), Expect = 0.91 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +3 Query: 264 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 419 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 420 KFGFYEVFKVAYAGMLDD 473 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 422 A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 158 ATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLN 217 Query: 423 FGFYEVFK 446 F YE K Sbjct: 218 FSVYESLK 225 Score = 35.1 bits (77), Expect = 0.042 Identities = 25/64 (39%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 425 AV PL+ +K LQV KY V G K R EG+RGL KG KF Sbjct: 55 AVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKF 114 Query: 426 GFYE 437 YE Sbjct: 115 FSYE 118 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 443 PL+++K RL V E Y ++ R +G+RG G PT +G C + Y+ Sbjct: 179 PLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKM 238 Query: 444 KVAY 455 K +Y Sbjct: 239 KTSY 242 Score = 33.1 bits (72), Expect = 0.17 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 PL++ + RL V A K + N+ V++EGV GL +GW + + + FY Sbjct: 273 PLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMPSSGITWVFY 332 Query: 435 EVFK 446 E +K Sbjct: 333 EAWK 336 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 41.1 bits (92), Expect = 6e-04 Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 416 A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 23 AMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTVSWG 82 Query: 417 CKFGFYEVFKVAYAGMLDDE 476 F FY K YA DDE Sbjct: 83 LYFFFYGRAKQRYARGRDDE 102 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 41.1 bits (92), Expect = 6e-04 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +3 Query: 264 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 PLD++K RL V +YK V + K +REEG L KG P + + G FG E Sbjct: 252 PLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLE 311 Query: 438 VFK 446 K Sbjct: 312 KTK 314 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.7 bits (91), Expect = 9e-04 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +3 Query: 264 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 438 VFKVAY 455 +F+ A+ Sbjct: 92 MFQTAF 97 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +3 Query: 258 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 389 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +3 Query: 249 PHAVVPLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 386 P P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 225 PFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 9e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +3 Query: 264 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 416 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 417 CKFGFYEVFK 446 KF FYE K Sbjct: 193 LKFYFYEEMK 202 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 40.7 bits (91), Expect = 9e-04 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +3 Query: 264 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 425 PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + ++ + Sbjct: 252 PLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRMLFHAPAAAICW 311 Query: 426 GFYEVFK 446 YE K Sbjct: 312 STYETVK 318 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/70 (31%), Positives = 30/70 (42%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 443 P+D+VK RLQ+ YK V + K REEG + T + + F YE Sbjct: 152 PMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVHFTTYEAV 211 Query: 444 KVAYAGMLDD 473 K ML + Sbjct: 212 KRGLREMLPE 221 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 443 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 444 K 446 K Sbjct: 385 K 385 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 38.3 bits (85), Expect = 0.005 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +3 Query: 261 VPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 413 +PLD K RLQ V KY+ ++ REEG+R L KG P + G Sbjct: 30 IPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFG 89 Query: 414 LCKFGFYEVFKVAYAG 461 + G YE K Y G Sbjct: 90 GLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.024 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +3 Query: 264 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 422 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 423 FGFYEVFK 446 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.042 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 392 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 37.9 bits (84), Expect = 0.006 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 419 A PL +VK RLQ + YK+ + + EEG+RGL G P G S + Sbjct: 130 ATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVAI- 188 Query: 420 KFGFYEVFKVAYA 458 +F YE+ KV A Sbjct: 189 QFPTYEMIKVYLA 201 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 8/71 (11%) Frame = +3 Query: 258 VVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 413 V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 31 VCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLSNW 90 Query: 414 LCKFGFYEVFK 446 F Y+ K Sbjct: 91 AIYFTMYDQLK 101 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +3 Query: 258 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 386 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 33.9 bits (74), Expect = 0.098 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 15/84 (17%) Frame = +3 Query: 264 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 398 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 399 YSMQGLCKFGFYEVFKVAYAGMLD 470 F YE FK AG D Sbjct: 184 EVPGNATMFAAYEAFKRFLAGGSD 207 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 37.5 bits (83), Expect = 0.008 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 419 A PL +VK RL + YK+V++ F EEGVRGL G P+ G S + Sbjct: 134 ATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVAI- 192 Query: 420 KFGFYEVFKVAYAGM 464 +F YE K A M Sbjct: 193 QFPAYEKIKQYMAKM 207 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 8/71 (11%) Frame = +3 Query: 258 VVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 413 V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 35 VCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNW 94 Query: 414 LCKFGFYEVFK 446 F Y K Sbjct: 95 AVYFSVYGKLK 105 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +3 Query: 249 PHAVVPLDLVKCRLQVDAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 425 PH V+ L + +AE KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 426 GFYEVFKVAYAGMLDDET 479 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 36.7 bits (81), Expect = 0.014 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +3 Query: 264 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 438 VFK 446 FK Sbjct: 206 TFK 208 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 36.3 bits (80), Expect = 0.018 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 261 VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 +PLD ++ +L E + F+ ++ EG+ L KG P+ ++ G +G Y+ Sbjct: 160 LPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMALSGAVFYGVYD 219 Query: 438 VFKVAY 455 + K ++ Sbjct: 220 ILKSSF 225 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.024 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 392 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 34.3 bits (75), Expect = 0.074 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +3 Query: 261 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 410 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 411 GLCKFGFYEVFKVAYAG 461 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.042 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 264 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 438 VFK 446 +FK Sbjct: 211 MFK 213 Score = 29.5 bits (63), Expect = 2.1 Identities = 28/120 (23%), Positives = 43/120 (35%), Gaps = 2/120 (1%) Frame = +3 Query: 300 AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDET 479 A KY +V K REEG RG +G P + +F K +G E Sbjct: 66 ASKYTGMVQATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKTED 125 Query: 480 AYTYRTFVYXXXXXXXNSSPTSPCRPWRRLRSV--SKTMPGFASTLREGVAEDGQERRLR 653 ++ + T P+ LR++ S+ P T+R + Q R +R Sbjct: 126 HIHLSPYLSFVSGALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIR 185 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.042 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 435 EV 440 EV Sbjct: 277 EV 278 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 34.7 bits (76), Expect = 0.056 Identities = 21/76 (27%), Positives = 36/76 (47%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 A PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Y Sbjct: 225 ATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKFYAY 283 Query: 435 EVFKVAYAGMLDDETA 482 E+FK A + ++ A Sbjct: 284 ELFKNAIGENMGEDKA 299 Score = 34.7 bits (76), Expect = 0.056 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 258 VVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 434 V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + + Y Sbjct: 420 VYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYMVY 477 Query: 435 EVFK 446 E K Sbjct: 478 EAMK 481 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVRE----EGVRGLAKGWAPTFIGYSMQGLCK 422 ++ PLDLVK RLQ + V ++ EG R KG P+ +G Sbjct: 320 SIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYKGLFPSLLGIIPYAGID 379 Query: 423 FGFYEVFK 446 YE K Sbjct: 380 LAAYETLK 387 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 34.7 bits (76), Expect = 0.056 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 9/77 (11%) Frame = +3 Query: 267 LDLVKCRLQVDAEK--------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 422 LD + RL DA++ +K +++ ++ ++ +G++GL +G+ + +G ++ Sbjct: 136 LDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRGFGVSIVGITLYRGMY 195 Query: 423 FGFYEVFK-VAYAGMLD 470 FG Y+ K + G L+ Sbjct: 196 FGMYDTIKPIVLVGSLE 212 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 34.3 bits (75), Expect = 0.074 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +3 Query: 261 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 410 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 411 GLCKFGFYEVFKVAYAG 461 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 33.9 bits (74), Expect = 0.098 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +3 Query: 258 VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 V PL +++ R+Q D+ K ++ F ++R EG++G +G P F + YE Sbjct: 411 VYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYE 469 Query: 438 VFK 446 K Sbjct: 470 AMK 472 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.9 bits (74), Expect = 0.098 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 252 HAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 401 + PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 267 YLTTPLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 33.9 bits (74), Expect = 0.098 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 443 P+D+VK RLQ+ YK V + K +REEG+ + T + + F YE Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAA 209 Query: 444 K 446 K Sbjct: 210 K 210 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Frame = +3 Query: 264 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 425 PLD+VK +LQ D ++ + + V+++G RGL +GW P + ++ + Sbjct: 247 PLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRMLFHAPAAAICW 306 Query: 426 GFYEVFKVAYAGM-LDDETA 482 YE K + +D TA Sbjct: 307 STYEGVKSFFQDFNVDSNTA 326 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 33.1 bits (72), Expect = 0.17 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGF 431 PLD+VK RLQ+ + + G F ++ EG R L G P + G + G Sbjct: 83 PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRSVLYGGLRLGL 142 Query: 432 YEVFKVAY 455 YE KV++ Sbjct: 143 YEPTKVSF 150 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +3 Query: 264 PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 PLD +K RLQV E + K + E+G +G +G P F S G YE Sbjct: 254 PLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAWGTSMILTYE 313 Query: 438 VFK 446 K Sbjct: 314 YLK 316 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +3 Query: 258 VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 V PL +V+ R+Q D+ K + F +++ EG+RG +G P + + YE Sbjct: 412 VYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYE 470 Query: 438 VFK 446 K Sbjct: 471 AMK 473 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYSMQGLCKF 425 A+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 313 AIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVPYAGIDL 372 Query: 426 GFYEVFK 446 YE K Sbjct: 373 AAYETLK 379 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 264 PLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ + YE Sbjct: 235 PADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYE 294 Query: 438 VFKV 449 F++ Sbjct: 295 KFRL 298 Score = 31.5 bits (68), Expect = 0.52 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +3 Query: 264 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 386 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 386 PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 297 PLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +3 Query: 291 QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLD 470 Q A+K + + +EEGV+G KG P I + YE +K + G D Sbjct: 124 QQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKGK-D 182 Query: 471 DE 476 D+ Sbjct: 183 DQ 184 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 31.5 bits (68), Expect = 0.52 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSMQGLCKFGFYEV 440 P D++K R+ ++ VS+ R EG GL KG P F + G F YE+ Sbjct: 741 PFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYEL 800 Query: 441 FKVA 452 K A Sbjct: 801 AKKA 804 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 30.7 bits (66), Expect = 0.91 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +3 Query: 255 AVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAKG 377 A P+D V+ R+ + +A KYK+ + F V++EG + L KG Sbjct: 307 ASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKG 350 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 303 EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 446 E YK + + F ++R+EG+ L +G I Y F F + FK Sbjct: 126 EPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFK 173 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 0.91 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 309 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 446 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 255 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 398 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 2.1 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +3 Query: 297 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 446 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 6/52 (11%) Frame = +3 Query: 255 AVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 392 A PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 260 ATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +3 Query: 261 VPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 395 +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 136 IPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 342 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 446 +REEG+R L G + T + ++ + G Y++ K Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK 106 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 300 AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 446 +E YK + + F +V++EG+ L +G I Y F F + FK Sbjct: 120 SEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFKDYFK 168 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 264 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 389 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 623 HAFAEGARETRHGFGYGP*PPPWATGRCRR*IPPTQTP 510 H FA + + +HG+GY PPP + G P TQ P Sbjct: 286 HGFAPSSPQNQHGYGY---PPPTSPGYGYG-CPTTQVP 319 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = +3 Query: 258 VVPLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 422 V PLD+ RL D A +++ + + +++GVRG+ +G + G + Sbjct: 159 VYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLY 218 Query: 423 FGFYEVFKVAYA 458 FG ++ K ++ Sbjct: 219 FGGFDTVKEIFS 230 >At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 472 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Frame = +3 Query: 396 GYSMQGLCKFGFYEVFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSPCRPWRRLRS 575 G + GLC+FG + K + M++ + A T T+ + + R ++S Sbjct: 196 GTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKS 255 Query: 576 VSKTMPGFA-STLREGVAEDGQ 638 F S+L +G+ +DG+ Sbjct: 256 KGIEPNVFTYSSLMDGLCKDGR 277 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 239 HDRTPPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 105 H + P PQ + D N+ + + A+ A+ S ATG VDW Sbjct: 151 HQQQNPNPQHQQR--DANNPAGLLSIAEEALAEFLSKATGTAVDW 193 >At1g52620.1 68414.m05941 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 819 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +3 Query: 318 VVNGFKVSVREEGVRGLAKGWAPTFIGYSM--QGLCKFGFYEVFKVAYAGMLDDE---TA 482 VV+G V+ + +G +P Y+M GLCK G + K+ ++ MLD A Sbjct: 426 VVSGHMDDAVNMKVKLIDRGVSPDAAIYNMLMSGLCKTGRFLPAKLLFSEMLDRNILPDA 485 Query: 483 YTYRTFV 503 Y Y T + Sbjct: 486 YVYATLI 492 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 343 TDTLKPFTTFLYFSASTWRRHFTRSRG 263 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.4 Identities = 24/97 (24%), Positives = 35/97 (36%), Gaps = 2/97 (2%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 438 VFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSP 548 + Y D F+ + TSP Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAGLVGGAAETVMTSP 126 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.4 Identities = 24/97 (24%), Positives = 35/97 (36%), Gaps = 2/97 (2%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 438 VFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSP 548 + Y D F+ + TSP Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAGLVGGAAETVMTSP 126 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.4 Identities = 24/97 (24%), Positives = 35/97 (36%), Gaps = 2/97 (2%) Frame = +3 Query: 264 PLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 437 PLD +K +QV + K + + F +R G GL G +G +FG YE Sbjct: 30 PLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGARFGVYE 89 Query: 438 VFKVAYAGMLDDETAYTYRTFVYXXXXXXXNSSPTSP 548 + Y D F+ + TSP Sbjct: 90 ILTAFYKDGRHDNYVSVGEAFLAGLVGGAAETVMTSP 126 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 285 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 425 R + EK + + GF+ V+ +G+ + +GWAP + Q C F Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF 369 >At1g12700.1 68414.m01473 helicase domain-containing protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles PF01535: PPR repeat, PF00271: Helicase conserved C-terminal domain Length = 828 Score = 27.5 bits (58), Expect = 8.5 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 7/85 (8%) Frame = +3 Query: 204 FRSLRSWWCSVMRSDPHAVVPLDLVKCRLQVDAEKYKNVVNGF----KVSVREEGVRGL- 368 F SL +C V R D V ++ K L +A Y +V GF K+ + EE + + Sbjct: 361 FTSLIKGYCMVKRVDDGMKVFRNISKRGLVANAVTYSILVQGFCQSGKIKLAEELFQEMV 420 Query: 369 AKGWAPTFIGYS--MQGLCKFGFYE 437 + G P + Y + GLC G E Sbjct: 421 SHGVLPDVMTYGILLDGLCDNGKLE 445 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,620,991 Number of Sequences: 28952 Number of extensions: 287971 Number of successful extensions: 975 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -