BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120513.Seq (624 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 146 1e-35 SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 137 6e-33 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 9e-31 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 6e-18 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 85 6e-17 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 34 0.082 SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 33 0.14 SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) 33 0.19 SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) 31 0.57 SB_9232| Best HMM Match : Coq4 (HMM E-Value=1.8) 29 3.1 SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) 27 9.4 SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) 27 9.4 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 146 bits (355), Expect = 1e-35 Identities = 64/83 (77%), Positives = 77/83 (92%) Frame = +1 Query: 259 KTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAG 438 KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+IA G Sbjct: 5 KTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDIAQG 64 Query: 439 VHENRNDEEVGAGDQGLMFGYAT 507 VH R+DE++GAGDQGLMFGYAT Sbjct: 65 VHIGRSDEDLGAGDQGLMFGYAT 87 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = +3 Query: 483 GLDVRLCNSETEECMPLTVVLAHKLNPKIAELRRNG 590 GL ET+E MPLTVVLAH LN ++A+ RRNG Sbjct: 80 GLMFGYATDETDELMPLTVVLAHGLNKRLADCRRNG 115 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 137 bits (332), Expect = 6e-33 Identities = 62/83 (74%), Positives = 72/83 (86%) Frame = +1 Query: 259 KTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAG 438 KTGM+LLCGEITS A VDYQ VVR+ +K IGYDDS KGFDYKTC+V++AL+QQS +IA G Sbjct: 74 KTGMILLCGEITSNAVVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDIAHG 133 Query: 439 VHENRNDEEVGAGDQGLMFGYAT 507 VH R +E+VGAGDQGLMFGYAT Sbjct: 134 VHVGREEEDVGAGDQGLMFGYAT 156 Score = 89.4 bits (212), Expect = 2e-18 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +2 Query: 125 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETKLK 262 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACET K Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAK 74 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +3 Query: 483 GLDVRLCNSETEECMPLTVVLAHKLNPKIAELRRNG 590 GL ETEE MPLTVVLAHK+N K+AE RR+G Sbjct: 149 GLMFGYATDETEELMPLTVVLAHKMNQKLAEYRRDG 184 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 130 bits (314), Expect = 9e-31 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = +1 Query: 256 TKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAA 435 TKTG+VLL GEITS A VDYQ VVR T++ IGY+DSS GFDYKTCSV+LA+ +Q IA Sbjct: 94 TKTGLVLLFGEITSNARVDYQAVVRNTIRDIGYNDSSTGFDYKTCSVLLAIQEQVAEIAQ 153 Query: 436 GVHENRNDEEVGAGDQGLMFGYAT 507 VH NR D+E+GAGDQGLMFGYAT Sbjct: 154 TVHLNRRDDEIGAGDQGLMFGYAT 177 Score = 84.2 bits (199), Expect = 8e-17 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = +2 Query: 107 YDMEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETKLK 262 Y D FLFTSESV EGH DKMCDQISDA+LDAHL QDP AKVACET K Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQISDAVLDAHLEQDPYAKVACETATK 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = +3 Query: 483 GLDVRLCNSETEECMPLTVVLAHKLNPKIAELRR 584 GL ETEE MPLT VLAHKL ++AE R+ Sbjct: 170 GLMFGYATDETEELMPLTTVLAHKLCARLAECRK 203 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 87.8 bits (208), Expect = 6e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 125 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETKLK 262 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACE+ K Sbjct: 9 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACESVAK 54 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 259 KTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSK 369 KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSK Sbjct: 54 KTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSK 90 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 84.6 bits (200), Expect = 6e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 125 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVAC 247 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVAC Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVAC 69 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 34.3 bits (75), Expect = 0.082 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 460 EEVGAGDQGLMFGYAT 507 E+ GAGDQGLMFGYAT Sbjct: 8 EDQGAGDQGLMFGYAT 23 Score = 33.1 bits (72), Expect = 0.19 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 483 GLDVRLCNSETEECMPLTVVLAHKLNPKIAELRRNG 590 GL +ET+ MP V AH+L + +ELRRNG Sbjct: 16 GLMFGYATNETDSLMPAPVYYAHRLVERQSELRRNG 51 >SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 9 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 143 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 416 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 461 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 9 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 143 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 70 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 115 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -1 Query: 318 LIIHVSFGCDFATQ--KHHTGFSLVSHATFASGS*FRCASRIASLIWSHILSG 166 L H++F C + H S +S + A + FRC+ R S++W H+ +G Sbjct: 263 LTCHLNFACRVCRTYPRLHVIPSSISDSDLAKVASFRCSGRFPSIVWRHMTNG 315 >SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) Length = 681 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 517 SVSLLHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGL 407 S++ L N T+ P + PQ P H SHA + ++I G+ Sbjct: 95 SLATLGNETARPAIAPQEPEHLVSHANKILTVIIQGM 131 >SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) Length = 390 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 283 GEITSKANVDYQKVVRETV---KHIGYDDSSKGFDYK 384 GEITS N+D +K+ + K I YD G+DY+ Sbjct: 103 GEITSNVNIDREKLPGSNLLEFKAIAYDAKGAGYDYR 139 >SB_9232| Best HMM Match : Coq4 (HMM E-Value=1.8) Length = 1392 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 480 PGLDVRLCNSETEECMPLTVVLAHKLNPKIAE 575 PG D R +S + PLT AHK +PK+++ Sbjct: 548 PGFDSRAGSSSGKLSKPLTKTKAHKQSPKVSK 579 >SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 155 GEGHPDKMCDQISDAILDAHLNQDPDAKVACETKLKPVWCFCVAKSHPKL 304 G G D++ + +L A +N A T+ KPV + +A HP++ Sbjct: 391 GLGRLDRLVEAFVYTVLGAQVNVRSSIANAINTETKPVGAYNMAGGHPRV 440 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 56 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 232 MP G +K N + D D +L +S+ + D++C + I AHL QDPD Sbjct: 196 MPYGGGKRGKSKKNSSTLDTGDLETWLKGRKSITRVRNHDELCAARALVIGMAHLTQDPD 255 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 56 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 232 MP + G +K N + D D +L S+ + D++C + I AHL +DPD Sbjct: 241 MPFGAGKRGKSKKNSSTLDTGDLETWLKGKRSITRVRNHDELCAARATVIGMAHLTKDPD 300 >SB_34202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 610 WSCPQNSPFRLSSAIFGLSLCASTTVNGMHSSVSLLHN 497 W CP R S+ G LC S + NG+ S S ++ Sbjct: 355 WICPPVQSIRALSSSQGYDLCRSASGNGVSSIESAFYS 392 >SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) Length = 334 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 466 LPRHFCSHAPQQQCLVIVGLVRASHCMSCNQSL-WTNHHN 350 L R FC +C+ I+G R S+ + W HH+ Sbjct: 106 LSRLFCERLDSNECVFIIGAQRFSNYTGYAHTFKWAGHHD 145 >SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) Length = 323 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 339 DRFAHNFLIIHVSFGCDFATQKHHTGFSLV 250 D F NF++I + CDF T K+ +G LV Sbjct: 208 DSFITNFVVIVLLLSCDFWTVKNVSGRLLV 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,974,967 Number of Sequences: 59808 Number of extensions: 499887 Number of successful extensions: 1512 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1506 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -