BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120508.Seq (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo... 30 0.27 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 29 0.63 SPCC777.13 |vps35||retromer complex subunit Vps35|Schizosaccharo... 28 1.1 SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces pom... 27 1.9 SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosac... 27 3.3 SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosacch... 27 3.3 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 26 4.4 SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharo... 25 7.7 SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 25 7.7 SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc... 25 7.7 SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy... 25 7.7 SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 25 7.7 >SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizosaccharomyces pombe|chr 1|||Manual Length = 1604 Score = 30.3 bits (65), Expect = 0.27 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +3 Query: 21 QIKSMTDERGNFYYNTPPPPLRY--PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSR 194 QI +RGN + +PPPPL Y P AT NA NNA TT N + Sbjct: 48 QIPLYWQQRGNEFQASPPPPLGYVTPEYGATGTPVNA---NNASRVDYATTAANVPEEYA 104 Query: 195 SNSTNSVA 218 ++ ++ +A Sbjct: 105 NDYSSELA 112 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 29.1 bits (62), Expect = 0.63 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = +3 Query: 63 NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSK 242 +TPPP +PS T+ T++ + +P + + K ++ S + A S Sbjct: 690 STPPPTTSFPSTFTTSFITSSSLSS-----IPNNSTEVKTASTSSGTEIKTASTSSGSSS 744 Query: 243 EPTLTPANLFGTT 281 + TPA+ TT Sbjct: 745 SSSYTPASSTSTT 757 >SPCC777.13 |vps35||retromer complex subunit Vps35|Schizosaccharomyces pombe|chr 3|||Manual Length = 785 Score = 28.3 bits (60), Expect = 1.1 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = +2 Query: 257 AGESIWY------NKCVDFVQKIIRYYRCNDMSELSPLMIHFINT 373 AGE++ Y N+C+ F+ + R ++C D +E L+ F+NT Sbjct: 497 AGENVKYLLPVVVNRCI-FLARNFRIFKCMDWAEKVRLLWEFVNT 540 >SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces pombe|chr 2|||Manual Length = 558 Score = 27.5 bits (58), Expect = 1.9 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 129 TYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTLTPANLFGT 278 T N AP V +D+ + + NS P N+ +P L PAN F T Sbjct: 27 TENLAPAVVD-NVKDDLIVSKGGNSRELARNVPVNEMVQPALGPANPFVT 75 >SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 26.6 bits (56), Expect = 3.3 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 149 VRAAYDARQQNGHEPQQQHK-LGSDRTVQQEQRTDAHAGESI 271 + A Y ++ ++P Q K +G+D V+ EQ+ D+H ESI Sbjct: 76 IDAIYQNIEKTTNKPAQLWKAVGNDEVVESEQQ-DSHDAESI 116 >SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 192 RSNSTNSVAIAPYNKSKEPTLTPANLFGTTNVWILFKKLLDITGAM 329 R T + + K++E P + GT+NV+ K L+++G + Sbjct: 176 RDPHTQEIVLQGLMKAQEDFKGPGSFLGTSNVYFAAKYNLNVSGTV 221 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 26.2 bits (55), Expect = 4.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 75 PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 218 PP+ P+ + TN+ ++A G+ PP K++ RS+S N A Sbjct: 536 PPIVKPNLMSEPTPTNSDEKSHALGFPPPP--GQKIEFQRSSSKNGTA 581 >SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 15 RVQIKSMTDERGNFYY-NTPPPPLRYPS 95 R+Q+ T G++ + N PPP LR P+ Sbjct: 63 RLQLYKKTISEGDYNFDNVPPPELRTPT 90 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 161 YDARQQNGHEPQQQHKLGSDRTVQQEQR 244 Y QQN E Q HK D+ QE++ Sbjct: 600 YLGNQQNAVEGDQDHKKKGDKETTQEEK 627 >SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1284 Score = 25.4 bits (53), Expect = 7.7 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -3 Query: 575 NFCAYAGSEFSTNDA*NIF---ESLAGTRPRCLVPTLFATES 459 + CA+ + ++ A N+F E L P C VP+ +TES Sbjct: 653 DICAFPNAGLNSIYARNLFNTVEQLQSVLPNCHVPSNLSTES 694 >SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 991 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 45 RGNFYYNTPPPPLRYPSNPATAIFTNAQTYNN 140 RG Y N PP Y SN ++YNN Sbjct: 953 RGGGYSNGPPAGNHYSSNRGKGYGYQRESYNN 984 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 550 NLAQTMPEIYSNRSQGLGRVALSQLFLQPN 461 N+ MPEI ++ G R+ L F QPN Sbjct: 435 NVVVYMPEIDKDKLGGTMRLGLRPTFFQPN 464 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,633,068 Number of Sequences: 5004 Number of extensions: 53698 Number of successful extensions: 223 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -