BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120507.Seq (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 28 1.5 SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosa... 28 1.5 SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizos... 26 6.2 SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 26 6.2 SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces ... 25 8.2 SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Ma... 25 8.2 >SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 188 LFNSILHDVQCYVIFAPCHPVCV-SRLHLLGTLTSF 292 LFN + D QCY+ + P VC+ S L SF Sbjct: 158 LFNQVRVDCQCYIHYLPKLAVCILSNFFLQDAYISF 193 >SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 63 VKISLNTNKIVNEKNSS*LKYWQSFHIDFTKMMPGK 170 V + LNT +I+N K+S + YW D T PG+ Sbjct: 507 VMLMLNTKRIMNPKDSDAVGYWIEAEDDST-FFPGR 541 >SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 790 Score = 25.8 bits (54), Expect = 6.2 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%) Frame = -2 Query: 472 YVLLNVKVSFNRCLPS*S*RSKFQR-LSSHSDFRGLETFMCFGNIETQVSGIIWK*RLK* 296 Y +L VKV+ N + + R+ +++ + S SD + + F +ET++ G I + RL Sbjct: 628 YNVLLVKVALNYGVLAT--RTVYEKAIESLSDSEVKDMCLRFAEMETKL-GEIDRARLIY 684 Query: 295 LKGSESSQ*MQTRHTYWMAWSKYDV 221 + GS+ + YW AW ++++ Sbjct: 685 IHGSQYCD-PRVETDYWKAWQEFEI 708 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 25.8 bits (54), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 186 CYLIVFYMMCNVTSYLLHAIQYVCRVCIY 272 CY +V M C +H + VC +C++ Sbjct: 1256 CYSLVPRMSCTFCCLSIHGLCIVCGLCLH 1284 >SPCC1235.14 |ght5||hexose transporter Ght5 |Schizosaccharomyces pombe|chr 3|||Manual Length = 546 Score = 25.4 bits (53), Expect = 8.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 247 SMCVAFAFTGNSHFL*VISVFTSILCLRPGFQY 345 S C A A TGN + +IS FT + GF+Y Sbjct: 401 SKCAAVATTGNWLWGFLISFFTPFITNSIGFKY 433 >SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 630 Score = 25.4 bits (53), Expect = 8.2 Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 1/89 (1%) Frame = +3 Query: 21 YMQLHISIFIDLVFVKISLNTNKIVNEKNSS*LKYWQSFHIDFTKMMPGKL*QFLCYLIV 200 Y +SIF F + +N ++ E S L +Q H +M+P + +F I Sbjct: 86 YSYERVSIFWLPYFRSLGVNVPIVLCENKSEDLDNYQGLHTIEHEMIP-LINEF--KEIE 142 Query: 201 FYMMCNVTSYL-LHAIQYVCRVCIYWELS 284 ++C+ + ++ + Y+CR C+ + ++ Sbjct: 143 ACILCSALEKINVNELFYMCRACVIYPIT 171 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,837,071 Number of Sequences: 5004 Number of extensions: 57995 Number of successful extensions: 101 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -