BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120507.Seq (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1020 + 23344657-23346969 28 8.5 04_01_0146 + 1701744-1701860,1702036-1702112,1702247-1702344,170... 28 8.5 >07_03_1020 + 23344657-23346969 Length = 770 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 450 LVSTGVYPVNPKEASFNDCQAIPILGVWKPSCV 352 ++ +G++P NP SFND + WK CV Sbjct: 163 VIDSGIWPENP---SFNDSGLAAVRRSWKGGCV 192 >04_01_0146 + 1701744-1701860,1702036-1702112,1702247-1702344, 1704073-1704228,1704671-1705290,1705397-1705458, 1705551-1705941,1706404-1706575,1706686-1707212 Length = 739 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 450 LVSTGVYPVNPKEASFNDCQAIPILGVWKPSCVLG 346 ++ TG++P + ASF+D PI WK C G Sbjct: 146 IIDTGIWP---ESASFSDHGLSPIPSKWKGQCQAG 177 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,350,519 Number of Sequences: 37544 Number of extensions: 307534 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -