BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120507.Seq (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 24 5.4 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 23 9.5 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 507 NYYYNFREATVNKDLEWYGFLLKIRKRSPVCIHTNNFLILIITC 638 +Y+Y+ R A +N DLE L R R+ + ++I C Sbjct: 173 SYFYHSRVAELNNDLESIRSFLHSRLRTATLRNDFEGQAVLINC 216 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 647 FYMTSIHNCYAESIYGTCTCLI 712 +Y+ + +CYAES GT ++ Sbjct: 171 YYVLTAAHCYAESADGTLPSIV 192 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,289 Number of Sequences: 2352 Number of extensions: 14289 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -