BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120507.Seq (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical ... 30 1.9 Z71265-2|CAA95834.2| 128|Caenorhabditis elegans Hypothetical pr... 28 5.8 >AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical protein F56D6.7 protein. Length = 327 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 189 YLIVFYMMCNVTSYLLHAIQYVCRVCIYWELSLPLSYFSLH 311 Y+++ Y+ C + LL+A++ WELS +SY+SL+ Sbjct: 152 YILLLYLGCCLKYALLYALESWFGGGRGWELSYGISYYSLY 192 >Z71265-2|CAA95834.2| 128|Caenorhabditis elegans Hypothetical protein M05B5.2 protein. Length = 128 Score = 28.3 bits (60), Expect = 5.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 408 SFNDCQAIPILGVWKPSC 355 ++N C P +G WKPSC Sbjct: 64 NYNWCCTFPYMGSWKPSC 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,480,984 Number of Sequences: 27780 Number of extensions: 320343 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -