BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120507.Seq (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 24 1.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 3.8 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.7 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 245 PVCVSRLHLLGTLTSFKLFQSSLPY 319 PVC +LH+ TS L Q +P+ Sbjct: 149 PVCAPKLHVFDLKTSNHLKQIEIPH 173 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 245 PVCVSRLHLLGTLTSFKLFQSSLPY 319 P+C +LH+ TS +L Q +P+ Sbjct: 152 PMCSPKLHVFDLNTSHQLKQVVMPH 176 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/46 (19%), Positives = 23/46 (50%) Frame = +3 Query: 207 MMCNVTSYLLHAIQYVCRVCIYWELSLPLSYFSLHFHIMPETWVSI 344 M+ N T Y + ++ CR W+ S+ + + +++ + W+ + Sbjct: 397 MVDNTTIYK-YDVRDGCRTPFQWDNSINAGFSKIAENLLEKNWLPV 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,794 Number of Sequences: 438 Number of extensions: 4013 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -