BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120504.Seq (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1200 + 31690611-31690914,31690993-31691293,31691391-31696251 33 0.28 12_02_0189 + 15165485-15168694 28 8.1 >04_04_1200 + 31690611-31690914,31690993-31691293,31691391-31696251 Length = 1821 Score = 32.7 bits (71), Expect = 0.28 Identities = 18/70 (25%), Positives = 28/70 (40%) Frame = +3 Query: 69 CIVVEIFKIGFLKHCSKRVVKRCVVGHIYNQFPPR*RTVLWRHFDFVAIQYLPSYRFPHI 248 C EI + +L H SK + C H++N PP + + + LP+ + Sbjct: 1022 CQKFEIERKSWLSHLSKLTIHDCPHLHVHNPLPP---STIVLELSIAKVSTLPTLKGSSN 1078 Query: 249 DNTAIWRPKD 278 IW P D Sbjct: 1079 GTLTIWLPND 1088 >12_02_0189 + 15165485-15168694 Length = 1069 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 218 LNGDEIEVSPEHRSLAWRELIINVANNTPLDNTFRTMFQKADFENFD 78 LNG ++ +L+WR+++ V NN D R F D + D Sbjct: 913 LNGCNLKYYESKLNLSWRKVLKEVMNNKESDENNRWEFLNPDASDSD 959 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,244,754 Number of Sequences: 37544 Number of extensions: 344052 Number of successful extensions: 763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -