BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120504.Seq (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52317| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 29 3.6 SB_13948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_52317| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 681 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 251 QHSNMATKRFFSGESSGEPLIKRMAMANSPKKIRENYKRIN 373 +H F G PLI++ M N+ +IRE Y IN Sbjct: 211 RHHTTDETSFIHGVDEHTPLIRKERMENAWDRIREKYPNIN 251 >SB_13948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = -1 Query: 278 IFWSPYCCVVNMWESIRWQILNGDEIEVSPEHRSLAWRELIINVANNTPLDNTFRTMFQK 99 I WSPY C+V++ ES + +++ + + PE +A ++ N T ++ FR ++ Sbjct: 113 ISWSPY-CIVSLIESAKGEVVLSPGVSMIPE--LMAKASVMYNPVVYTLMNARFRATLKR 169 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,786,547 Number of Sequences: 59808 Number of extensions: 439797 Number of successful extensions: 975 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -