BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120504.Seq (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 29 0.032 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 29 0.032 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 3.6 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 4.8 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.5 bits (63), Expect = 0.032 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N ++ + ++ N +YN + YN+ Sbjct: 79 KIISSLSNNTIHNNNYKYNYNNNNYNNNNYNKKLYYNI 116 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.5 bits (63), Expect = 0.032 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N ++ + ++ N +YN + YN+ Sbjct: 79 KIISSLSNNTIHNNNYKYNYNNNNYNNNNYNKKLYYNI 116 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N + K ++ N +YN + YN+ Sbjct: 80 KIISSLSNNTIHNNNY-----KYNYNNNNYNKKLYYNI 112 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N + K ++ N +YN + YN+ Sbjct: 80 KIISSLSNNTIHNNNY-----KYNYNNNNYNKKLYYNI 112 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N + K ++ N +YN + YN+ Sbjct: 80 KIISSLSNNTIHNNNY-----KYNYNNNNYNKKLYYNI 112 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -1 Query: 164 ELIINVANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++I +++NNT +N + K ++ N +YN + YN+ Sbjct: 80 KIISSLSNNTIHNNNY-----KYNYNNNNYNKKLYYNI 112 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 149 VANNTPLDNTFRTMFQKADFENFDYNTPIVYNL 51 ++NN PL N + ++ +YN + YN+ Sbjct: 82 ISNNNPLSNNYNYNNNYNNYNKHNYN-KLYYNI 113 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 4.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 106 NIVLNVLSSG-VLLATFIINSLHANERCSGDTS-ISSPFSICHRI 234 N++ N +G LLA + + NE CSG TS +C R+ Sbjct: 89 NVITNKTGNGGPLLAPYPDWTWAKNENCSGITSAYKIEIDMCDRL 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,221 Number of Sequences: 438 Number of extensions: 4417 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -