BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120503.Seq (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ... 97 5e-21 At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ... 97 6e-21 At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi... 96 1e-20 At4g16095.1 68417.m02440 disease resistance protein-related cont... 29 1.4 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 29 1.8 At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063... 29 2.4 At5g16500.1 68418.m01928 protein kinase family protein contains ... 27 7.4 At5g67370.1 68418.m08495 expressed protein similar to unknown pr... 27 9.8 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 27 9.8 At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase,... 27 9.8 At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase,... 27 9.8 >At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 97.5 bits (232), Expect = 5e-21 Identities = 40/77 (51%), Positives = 57/77 (74%) Frame = +3 Query: 21 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 200 TVKDV + VK AAHLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 201 YIRSPVGVKTVTKIFGG 251 Y+R +GV +I+GG Sbjct: 66 YLRGGLGVGAFRRIYGG 82 Score = 61.7 bits (143), Expect = 3e-10 Identities = 25/53 (47%), Positives = 38/53 (71%) Frame = +2 Query: 251 AQRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 409 ++RNG P HFC+SSG +AR LQ L+ + +V+ GGR +T+ G+RDLD++ Sbjct: 83 SKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKITSSGQRDLDQV 135 >At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S RIBOSOMAL PROTEIN S19 - Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 97.1 bits (231), Expect = 6e-21 Identities = 41/77 (53%), Positives = 56/77 (72%) Frame = +3 Query: 21 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 200 TVKDV VK A+HLK++GK+++P D+VKT R KELAPYDPDW+Y+R A++ R I Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query: 201 YIRSPVGVKTVTKIFGG 251 Y+R +GV +I+GG Sbjct: 66 YLRGGLGVGAFRRIYGG 82 Score = 64.5 bits (150), Expect = 4e-11 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +2 Query: 251 AQRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 409 ++RNG P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 83 SKRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRITSSGQRDLDQV 135 >At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar to 40S ribosomal protein S19 GB:P40978 [Oryza sativa] Length = 143 Score = 96.3 bits (229), Expect = 1e-20 Identities = 39/77 (50%), Positives = 56/77 (72%) Frame = +3 Query: 21 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 200 TVKDV VK A+HLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 201 YIRSPVGVKTVTKIFGG 251 Y+R +GV +I+GG Sbjct: 66 YLRGGLGVGAFRRIYGG 82 Score = 64.5 bits (150), Expect = 4e-11 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +2 Query: 251 AQRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 409 ++RNG P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 83 SKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQV 135 >At4g16095.1 68417.m02440 disease resistance protein-related contains weak similarity to rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 187 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 365 HRPELSQQASMPPTIAKPCVQYCLM 291 H P L Q PP + C++YC M Sbjct: 86 HMPRLPDQHRFPPNLTNICLRYCCM 110 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 66 AHLKKTGKVKVPEHMDLVK-TARFKELAPYDPDWFYVRCAAILRHIYIRS 212 +H + V P D + T F+ ++ ++ WF C+A++ H+ + S Sbjct: 15 SHSDSSSTVSCPNGTDFHQLTTVFRYVSGFNSSWFSSNCSAVITHVVLPS 64 >At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063: Domain of unknown function (DUF383) and PF04064: Domain of unknown function (DUF384) Length = 339 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 281 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQGRRDLDRI 409 FCRSSG A + + ++ + + K +DG ++L RR L +I Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQI 186 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.1 bits (57), Expect = 7.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 30 DVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 146 +VE D+ V A K+T + + E VKT F+ELA Sbjct: 30 NVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68 >At5g67370.1 68418.m08495 expressed protein similar to unknown protein (gb|AAC18972.1) Length = 327 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/38 (34%), Positives = 26/38 (68%) Frame = +1 Query: 145 LRMTLIGSMCVVLPSFVIFTFAHLLESRLSPRSSVGAT 258 L+ TLIG+ +++ +FV+F FA +E ++++G+T Sbjct: 221 LKQTLIGTGALLVSAFVLFVFATPVEDFF--KTTLGST 256 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 276 HISAGHQAVLHARLCNRWRH*SLLRKFRTVVAFSPHKVD 392 HIS G+ V+ A WR+ LR+ + FS H+++ Sbjct: 108 HISYGNSTVVSASYSEHWRN---LRRIGALEIFSAHRLN 143 >At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.8 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +3 Query: 21 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 197 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 >At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.8 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +3 Query: 21 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 197 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,048,303 Number of Sequences: 28952 Number of extensions: 196319 Number of successful extensions: 463 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -