BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120502.Seq (715 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08780.1 68418.m01041 histone H1/H5 family protein contains P... 32 0.43 At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative ... 29 2.3 At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-contain... 29 4.0 At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-contain... 29 4.0 At4g34100.1 68417.m04838 zinc finger (C3HC4-type RING finger) fa... 29 4.0 At2g02790.1 68415.m00222 calmodulin-binding family protein very ... 28 5.3 At1g13740.1 68414.m01613 expressed protein 28 5.3 At5g43490.1 68418.m05317 hypothetical protein similar to unknown... 28 7.1 At5g35695.1 68418.m04268 hypothetical protein 28 7.1 At4g37060.1 68417.m05248 patatin, putative similar to patatin-li... 28 7.1 At3g01370.1 68416.m00059 expressed protein contains Pfam domain,... 28 7.1 At1g70420.1 68414.m08102 expressed protein 28 7.1 At4g25320.1 68417.m03643 DNA-binding protein-related contains Pf... 27 9.3 At2g26340.1 68415.m03160 expressed protein 27 9.3 At1g60240.1 68414.m06784 apical meristem formation protein-relat... 27 9.3 >At5g08780.1 68418.m01041 histone H1/H5 family protein contains Pfam domain, PF00538: linker histone H1 and H5 family Length = 457 Score = 31.9 bits (69), Expect = 0.43 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 180 ERAIRVHVDGKYKST-FEHADQIQHHLQIAWQSRATRCICTHTQCSLP 320 E AI + KYK+ F H + + HHL + R C C + SLP Sbjct: 77 EDAISEFIKSKYKNLPFAHTNLLSHHLAKLVEKREILCDCNNDCYSLP 124 >At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative similar to GTL1 [Arabidopsis thaliana] GI:2664198 Length = 669 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -1 Query: 652 AMSAMRLASCAVSRRAFSQSCRAVSASRRATIISLANKMSDRL--LPPNL 509 A +A A SQ RA SASR A IISL K++ LPP+L Sbjct: 305 AWKRQEMARLAREHEVMSQE-RAASASRDAAIISLIQKITGHTIQLPPSL 353 >At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 870 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 54 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 194 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 822 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 54 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 194 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At4g34100.1 68417.m04838 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 1092 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 337 LNHARFGNEHCVWVQIQRVALLCHAIWRWCWI 242 ++ AR+ EH V+ +R ++L + IW+WC I Sbjct: 841 ISGARYAIEH---VKSKRTSVLLNQIWKWCGI 869 >At2g02790.1 68415.m00222 calmodulin-binding family protein very low similarity to SP|P12036 Neurofilament triplet H protein {Homo sapiens}; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 636 Score = 28.3 bits (60), Expect = 5.3 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 181 NGQYVSTSTASTNRRLSMPTKSSTISR*RG--KAGR--PAVFAPTHSAHYQI 324 NG S +T ++RR S+P K + G ++GR P+ APT SA +I Sbjct: 472 NGNVASENTKPSDRRASLPAKIENHHQDDGLTQSGRKIPSYMAPTASAKARI 523 >At1g13740.1 68414.m01613 expressed protein Length = 348 Score = 28.3 bits (60), Expect = 5.3 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 644 RHAVGQLRRFAARVFAILPSRFSVASSHNHFVGKQNERSVASAKSGW-PPSIFASDRQ 474 R + LRR A+ F V +S + V +NER V ++KSG+ + +S+RQ Sbjct: 124 RKEMQSLRRMEAKRRRCEKQSFRVGNSDDQTVSFENERWVTASKSGFLQRHLVSSNRQ 181 >At5g43490.1 68418.m05317 hypothetical protein similar to unknown protein (gb|AAF20218.1) Length = 131 Score = 27.9 bits (59), Expect = 7.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 233 CRPNP--APSPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYAIELQEWLL 391 C P+P A V + G+P PH L + ++ + + LP + QEWLL Sbjct: 33 CPPSPLAATMKVKVKENGEPSAKPPHPDLKYLNQILHVPTRELLPEIDDDQEWLL 87 >At5g35695.1 68418.m04268 hypothetical protein Length = 211 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 662 HVLRNVRHAVGQLRRFAARVFAILPSRFSVASSHNHFVGKQ 540 H L N+RH LR R+F I SRF++ S F K+ Sbjct: 87 HELFNLRHV--SLRNVIERIFGIFKSRFAIFKSAPPFSYKK 125 >At4g37060.1 68417.m05248 patatin, putative similar to patatin-like latex allergen [Hevea brasiliensis][PMID:10589016]; contains patatin domain PF01734 Length = 414 Score = 27.9 bits (59), Expect = 7.1 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +2 Query: 269 AKQGDPLYLH-PHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQV-LCTGKYAPAV 442 A Q + YL L + + L KS L I+L E +L + Q+ + TG Y PA Sbjct: 313 ALQSEDKYLRIDDDTLEGDASTLDLSTKSNLENLIKLGEKMLTNRVMQMNIDTGTYEPAA 372 Query: 443 EMDTND 460 E ND Sbjct: 373 ENINND 378 >At3g01370.1 68416.m00059 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 1011 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 550 LANKMSDRLLPPNLVGHRQFLRQIVNFGNN-IICIHFNGRRVLARA 416 LA DR+ PP LV + R+ V+ N+ I C +GR+ L ++ Sbjct: 13 LAKTFPDRIFPPFLVPNTLVSRRNVSRANSGIFCSSASGRKTLPQS 58 >At1g70420.1 68414.m08102 expressed protein Length = 272 Score = 27.9 bits (59), Expect = 7.1 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 181 NGQYVSTSTASTNRRLSMPTKSSTISR*RGKAGRPAVFAPTHSAHYQIW 327 NG ++ST+ST RLS KSS + + K + T SAH +++ Sbjct: 187 NGSSSTSSTSSTAARLSGVVKSSEKGKEKTKTDKKKDKMRTKSAHEKLY 235 >At4g25320.1 68417.m03643 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 404 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 199 TSTASTNRRLSMPTKSSTISR*RGKAGRPAVFAP 300 T A+T L+MPT++++ + + K GRP + P Sbjct: 64 TENAATPFSLTMPTENTSAEQLKKKRGRPRKYNP 97 >At2g26340.1 68415.m03160 expressed protein Length = 230 Score = 27.5 bits (58), Expect = 9.3 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 323 SGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDL 484 S ++MKS+L A+ + LL+ V QVL GK V ++ A DDL Sbjct: 165 SNATVVLMKSQLGTALTALDSLLQTVPSQVLDKGKAMVEVYRSASEEDAGSDDL 218 >At1g60240.1 68414.m06784 apical meristem formation protein-related contains similarity to CUC1 [Arabidopsis thaliana] gi|12060422|dbj|BAB20598 and NAM [Petunia x hybrida] gi|1279640|emb|CAA63101 Length = 175 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = -3 Query: 263 YLEMVLDLVGMLKRRFVLAVDVDTYCPFTIYIF*TAGDVLGHKSDWLLITEHVS 102 YL+M++D V + R F+ + DV P+T+++ T ++ H + + V+ Sbjct: 18 YLKMMIDNVNVWPRHFLRSEDVYCKNPWTLFV--TRDPIILHFGRYFFVNRSVN 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,025,720 Number of Sequences: 28952 Number of extensions: 381734 Number of successful extensions: 1144 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1144 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -