BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120501.Seq (755 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.4 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 21 9.4 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 9.4 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 9.4 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 9.4 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 474 KRNRLRRNH*IGQRRHHIQAPCR*QKSHR 388 K+ L+R+H + HH+Q+ Q HR Sbjct: 134 KQETLQRHHHLQNHHHHLQSTAV-QDHHR 161 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 388 TMRFLSTARRLNVVSALS 441 T R+LS RLN+ +LS Sbjct: 29 TTRYLSVCERLNLALSLS 46 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 386 IQNAITCVYLCIDRCGQLYGSKTLSDD 306 I + I + + +D C +L+G T DD Sbjct: 106 IDSIINIIRVRVDACDRLWGVDTGVDD 132 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 407 VDRNRIVIQNAITCVYLCIDRCGQLYGSKTLSDDCFM 297 VD+ +V + +ITC C+ L + D+ M Sbjct: 59 VDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIM 95 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 407 VDRNRIVIQNAITCVYLCIDRCGQLYGSKTLSDDCFM 297 VD+ +V + +ITC C+ L + D+ M Sbjct: 59 VDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIM 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,392 Number of Sequences: 438 Number of extensions: 4897 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -