BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120500.Seq (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 2.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 3.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 4.5 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 24 5.9 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 325 TVEEFTEKCPGMLVGVHCTHGINRTGYMV 411 T E+F + P + VHC+ G+ RTG + Sbjct: 1149 TKEQFGQDGP---ITVHCSAGVGRTGVFI 1174 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 3.4 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -1 Query: 688 VENIRPNPTVDWNNATDRLQSKRSKRSISFDSLEEAQQFENRIKYLLK 545 +E+ R P ++ N ++ S SLE+ QQF+ + LK Sbjct: 960 LEDFRATPFIECNGGKGHCHYYETQTSFWLVSLEDHQQFQRPEQQTLK 1007 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 331 EEFTEKCPGMLVGVHCTHGINR 396 +E E+CP L + C H I+R Sbjct: 474 DETNERCPVFLQWLDCVHQIHR 495 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 331 EEFTEKCPGMLVGVHCTHGINR 396 +E E+CP L + C H I+R Sbjct: 474 DETNERCPVFLQWLDCVHQIHR 495 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 363 QHAGTLFCKFFYRVNKFLNDA 301 +H G + KF + KF NDA Sbjct: 37 EHKGVEYGKFVHTAGKFYNDA 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 824,282 Number of Sequences: 2352 Number of extensions: 17696 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -