BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120499.Seq (816 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CB17A Cluster: hypothetical protein TTHERM_0029... 33 6.5 >UniRef50_UPI00006CB17A Cluster: hypothetical protein TTHERM_00299740; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00299740 - Tetrahymena thermophila SB210 Length = 765 Score = 33.5 bits (73), Expect = 6.5 Identities = 22/87 (25%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = +3 Query: 138 SYKSIVASENLE*NDYSLIIIRQLDTGALELCIELPLRYPMSCRPTTCMSSFEY--KIIL 311 S+K I ++ N+ L +R L A + I+ + ++ P + + F + IL Sbjct: 215 SFKLIFPKRSVIQNNSLLPFLRSL--AAKQTFIDEKIISNLNIDPKSYIKDFSQFTEAIL 272 Query: 312 RYVSYAEVATFYRRYLISQLKQKSRCI 392 +Y+ ++++ + Y+ YLIS+LK++++C+ Sbjct: 273 KYIHHSKIQSHYQ-YLISKLKEENKCL 298 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,351,450 Number of Sequences: 1657284 Number of extensions: 14071634 Number of successful extensions: 26764 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26762 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 70789333940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -