BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120499.Seq (816 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0791 + 23189778-23190173,23190336-23190554 34 0.12 >12_02_0791 + 23189778-23190173,23190336-23190554 Length = 204 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -2 Query: 179 VSFKVFTRNNRLVTKSNFHI-RVKFERREVSI*YMSQSRTIPLRIASRSKIFLNEYGEI 6 V+ K F NN L + R++++RR +S+ + R LR+ S K+F E G++ Sbjct: 133 VNIKSFASNNELAVMPQDRVQRLEWDRRYLSVLGVENKRLYELRLQSPEKVFKEEEGDL 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,563,612 Number of Sequences: 37544 Number of extensions: 352886 Number of successful extensions: 589 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -