BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120499.Seq (816 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 1.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 7.8 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.2 bits (50), Expect = 1.5 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 344 LSEVSHQPIKAKK*VYTGQVV*QLYIKVYNDSCHLHSRSHISVHDN 481 L + HQP + K V++ Q V ++V+ H H IS+ N Sbjct: 510 LKRLDHQPYQYKIAVHSEQNVPGAVVRVFLGPKHDHQGRPISISKN 555 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -2 Query: 749 INRILFSFVKETEFQQKKHFRAVSP 675 +N + S +KETE ++KK +++SP Sbjct: 526 LNALPPSSMKETEEEKKKTKQSLSP 550 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,890 Number of Sequences: 438 Number of extensions: 4784 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -