BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120499.Seq (816 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR... 28 6.4 At1g52325.1 68414.m05906 hypothetical protein 28 6.4 >At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1231 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 344 LSEVSHQPIKAKK*VYTGQVV*QLYIKVYNDSCHLHSRSHISVH 475 +SE+ +P+K V+ G + Y+KVY+ C HS++ +H Sbjct: 562 MSEMEEKPLKRA--VFVGMSSLR-YLKVYSSLCPTHSKTECKLH 602 >At1g52325.1 68414.m05906 hypothetical protein Length = 145 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 82 YHIETSRLSNLTRI*KLLLVTSRLLRVKTLNETI 183 +++E S S+L + L L S LLR+K LNE + Sbjct: 43 FYVEDSTSSSLIFLKTLFLQLSELLRIKLLNEKL 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,960,848 Number of Sequences: 28952 Number of extensions: 317283 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -