BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120497.Seq (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 28 9.5 >SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 458 IFNYFIRILFYYFTSI*YIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLIC 622 IF +L +Y+T YI + DRI ++ T GI+VI+G F++ C Sbjct: 58 IFWMTAAMLVFYYTDF-YIAVK--VDDRINRPWLYLGTALIGINVIVGLYFVVWC 109 >SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) Length = 242 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 456 LFLTILLGFYFT-ILQAYDI*KLLLQLLIEFMDP 554 L + +L G YF + A+D K L ++IEF+ P Sbjct: 92 LHIAVLQGKYFCDVTAAFDATKFLTSMMIEFLQP 125 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,845,195 Number of Sequences: 59808 Number of extensions: 208249 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -