BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120495.Seq (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 1.1 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 24 1.5 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 24 1.5 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 22 6.0 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 21 7.9 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 130 YECESRFRRTNRNIVVPANN*EQYKNLKFY 219 Y+CE R + P N+ EQY N +Y Sbjct: 64 YDCEGVIRHHGQWNYSPDNHFEQYPNPTYY 93 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 97 SSVKKTNSKHK-KFVYWPKDTNALVPLV 17 S V+ N K KF +WP NAL+ L+ Sbjct: 36 SLVRVENGKKVFKFAWWPLTRNALLVLI 63 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 97 SSVKKTNSKHK-KFVYWPKDTNALVPLV 17 S V+ N K KF +WP NAL+ L+ Sbjct: 36 SLVRVENGKKVFKFAWWPLTRNALLVLI 63 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 373 IVSFDACITYKSPCSPD 423 ++++ C+ K PCSP+ Sbjct: 53 LLNYINCLLEKGPCSPE 69 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 391 CITYKSPCSPD 423 C+ K PC+PD Sbjct: 48 CLLEKKPCTPD 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,119 Number of Sequences: 336 Number of extensions: 3757 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -