BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120488.Seq (823 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-2130|AAN13691.1| 1249|Drosophila melanogaster CG3992-PB... 31 1.4 AE014298-1753|AAF48147.2| 1860|Drosophila melanogaster CG2750-PA... 30 4.4 AE014134-3561|AAN11140.1| 600|Drosophila melanogaster CG31601-P... 29 7.7 >AE014297-2130|AAN13691.1| 1249|Drosophila melanogaster CG3992-PB, isoform B protein. Length = 1249 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 500 VANQIWRKQPIAHFVCQRNDCGSTRR*NGSARLRKRAPRNGAAGQPHGGHCA 655 ++ +WR+ H++C N CG + NG R + PR +A + G C+ Sbjct: 740 ISTPLWRRDNTGHYLC--NACGLYMKMNGMNRPLIKQPRRLSASKRAGLSCS 789 >AE014298-1753|AAF48147.2| 1860|Drosophila melanogaster CG2750-PA protein. Length = 1860 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -2 Query: 300 GCKYSGSPCFATLSGDGAGFGRHAQTSICTCRRRGHVLPVHNLHILNCWRC 148 G YS S C A ++ G +A S T R R +LP+ +L + C Sbjct: 801 GKSYSSSECLADVTMPSYGGNSYASRSKSTSRSRKSMLPIRDLSEMRTDEC 851 >AE014134-3561|AAN11140.1| 600|Drosophila melanogaster CG31601-PA protein. Length = 600 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 255 DGAGFGRHAQTSICTCRRRGHVLPVHNLHILNCWRCPWPQ 136 DG FG + S T ++ + +P+ HI NC C W Q Sbjct: 240 DGELFGEDNEVSSNTIKKEDNRMPICRYHIRNC--CIWGQ 277 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,428,152 Number of Sequences: 53049 Number of extensions: 923245 Number of successful extensions: 3004 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2995 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3880595628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -