BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120487.Seq (845 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.04c |ste4||adaptor protein Ste4|Schizosaccharomyces pom... 29 0.63 SPBC725.01 |||aspartate aminotransferase|Schizosaccharomyces pom... 27 3.3 SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 26 5.8 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 26 5.8 SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|... 26 7.7 SPAC1006.03c |||human CCDC131 homolog|Schizosaccharomyces pombe|... 26 7.7 >SPAC1565.04c |ste4||adaptor protein Ste4|Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 29.5 bits (63), Expect = 0.63 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -1 Query: 416 HRVDIINMDQFEQLINVSLLKSLIKTQIDENVSDNIKSMSEKLKRLECDNLT 261 HR+DI++ Q + L+ K Q +N+ ++ K + EK + L DN++ Sbjct: 59 HRIDILSAIQSMKKQQKDKLQQENKDQELKNIEESYKKLEEKTEHLSDDNVS 110 >SPBC725.01 |||aspartate aminotransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 437 Score = 27.1 bits (57), Expect = 3.3 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +3 Query: 582 NEEFKVILKNFITDLKKNQKLNYFNSLIDQLINVYTDTSAKNTQPDVLAKNY*IHLVL*A 761 +E K + K L+K+ K + I I ++ T Q DVLAK Y I+L Sbjct: 353 SERLKSMRKALRNILEKDLKNKHSWKHITDQIGMFCYTGLNPQQVDVLAKQYHIYLTKNG 412 Query: 762 RFAV 773 R ++ Sbjct: 413 RISI 416 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 26.2 bits (55), Expect = 5.8 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -3 Query: 342 NANRRKRVGQYQVDERKTKKARMRQSHRQLEIYGIHDNRLNNKKIR 205 N + VG Q E K + +++Q + + +G +DN +NKK R Sbjct: 256 NPETNESVGILQNQESK-RNEQIKQQYMPADNFGSNDNHSHNKKRR 300 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/40 (27%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -1 Query: 416 HRVD--IINMDQFEQLINVSLLKSLIKTQIDENVSDNIKS 303 HR++ ++ ++ E++ +S L++L+ Q+D N N+K+ Sbjct: 735 HRLEELLLGNNEIEEIEEISSLQNLMVLQLDNNKLTNLKA 774 >SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 194 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 339 ANRRKRVGQYQVDERKTKKARMRQSHRQLEIYGIHDNRLNNKKIRNYYLKK 187 ANR +R ++ +T+ SHR+ E Y H +R + NY+ K+ Sbjct: 132 ANRHRRK-----EKERTRSNHRHGSHRRHEPYRTHLSRHHRHSTTNYHSKR 177 >SPAC1006.03c |||human CCDC131 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 714 Score = 25.8 bits (54), Expect = 7.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 327 FVDLRFDQRLEQRHVNQLFKLIHINYINPMRIWCVKY 437 F RF+Q+ +R + L + N I PM+++C KY Sbjct: 586 FKSYRFNQQFVERVPLKYRSLTYSNKIEPMKVFC-KY 621 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,947,950 Number of Sequences: 5004 Number of extensions: 55626 Number of successful extensions: 176 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -