BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120487.Seq (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 8.8 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 23 8.8 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.4 bits (48), Expect = 8.8 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = -3 Query: 330 RKRVGQYQVDERKTKKARMRQSHRQLEIYGIHDNRLNNKK 211 R+ + QY+ + T K M ++ L++ + N NN++ Sbjct: 267 RELMDQYKQEHNTTTKVLMTEAWSSLDVVKTYFNDSNNRQ 306 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 437 IFYAPYTHRVDIINMDQFEQLINVSLLKSLIK 342 IF+ Y + IIN D ++ L+ +KS K Sbjct: 83 IFFIEYLQKGKIINSDYYKALLERLKVKSAAK 114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,494 Number of Sequences: 2352 Number of extensions: 13768 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -