Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120486.Seq
         (776 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein.            30   8.1  

>Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein.
          Length = 3570

 Score = 30.3 bits (65), Expect = 8.1
 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = +3

Query: 405  TTADVTVEGVNVLATPSSARITIGG-LALMHQATLP-AISATSTRSSNPRFHTPTTPDLT 578
            TTA  T       A PSS   T      L  QAT P A S+ +T SS+PR  T T P LT
Sbjct: 1644 TTAATTTATTGSTAIPSSTPGTAPPPKVLTSQATTPTATSSKATSSSSPRTAT-TLPVLT 1702

Query: 579  S 581
            S
Sbjct: 1703 S 1703


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,144,719
Number of Sequences: 237096
Number of extensions: 2268264
Number of successful extensions: 9746
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9746
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9423020542
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)