BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120486.Seq (776 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein. 30 8.1 >Z72496-1|CAA96577.1| 3570|Homo sapiens mucin MUC5B protein. Length = 3570 Score = 30.3 bits (65), Expect = 8.1 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 405 TTADVTVEGVNVLATPSSARITIGG-LALMHQATLP-AISATSTRSSNPRFHTPTTPDLT 578 TTA T A PSS T L QAT P A S+ +T SS+PR T T P LT Sbjct: 1644 TTAATTTATTGSTAIPSSTPGTAPPPKVLTSQATTPTATSSKATSSSSPRTAT-TLPVLT 1702 Query: 579 S 581 S Sbjct: 1703 S 1703 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,144,719 Number of Sequences: 237096 Number of extensions: 2268264 Number of successful extensions: 9746 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9746 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9423020542 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -