BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120479.Seq (830 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.7 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 4.9 CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 24 6.5 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 23 8.6 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 23 8.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/46 (19%), Positives = 25/46 (54%) Frame = +3 Query: 81 TALQKMVGNNEVELSEAEAEQYDRQIRLWGLDSQKRLRAAKVLIIG 218 T ++G++ ++ + D+Q+ LW ++R++ + +I+G Sbjct: 543 TTFSNIIGSSGPSVTSCTGSEIDKQVGLW----ERRVKGLRRMILG 584 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 659 RKKCPRNSFYNSKTSSYI 712 R+KCP+ Y KT +YI Sbjct: 533 RRKCPKTLSYLLKTKTYI 550 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 376 QRTLCSIYADLVRRTQKLG 320 QRT + Y +LVRRTQ G Sbjct: 3 QRTTMARYPELVRRTQGRG 21 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 Query: 393 KPRALSNEPSARFTPILSGGHRNWEYRSIC 304 KP L P ++ G WE R+IC Sbjct: 40 KPEFLKINPQHCIPTLVDNGFALWESRAIC 69 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 Query: 393 KPRALSNEPSARFTPILSGGHRNWEYRSIC 304 KP L P ++ G WE R+IC Sbjct: 40 KPEFLKINPQHCIPTLVDNGFALWESRAIC 69 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,720 Number of Sequences: 2352 Number of extensions: 15331 Number of successful extensions: 34 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -