BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120477.Seq (422 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.4 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 23 1.9 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 3.3 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 21 5.7 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 20 10.0 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 20 10.0 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 298 SKAKRGQATKSLRSLLLSDVWNVWLLIVACSVTSAAC 188 S K +ATK+L +++L WL C++ A C Sbjct: 610 SAKKERKATKTL-AIVLGVFLICWLPFFTCNIMDAIC 645 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -1 Query: 191 LSMNGSW--IFCMCEVYPGGVCNPSFCVC 111 LS+N S I C+ + GG C C+C Sbjct: 74 LSINHSACAIRCLAQRRKGGSCRNGVCIC 102 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.8 bits (44), Expect = 3.3 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 273 RNRFVPCYCRMCG 235 R +PC C +CG Sbjct: 37 RTHTLPCKCHLCG 49 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 21.0 bits (42), Expect = 5.7 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -1 Query: 83 GVSNHMWHRLKNDDGDDKP 27 G+S WH+ + G KP Sbjct: 2 GISRDHWHKRRATGGKRKP 20 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.2 bits (40), Expect = 10.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 105 IPAEERRRRVKPYVAPVEE 49 +P + RRRV+ + VEE Sbjct: 401 LPGNDARRRVEAALEAVEE 419 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.2 bits (40), Expect = 10.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 259 NEAISSPALVWLSTV 303 + AIS PA+VW V Sbjct: 174 SSAISFPAIVWWRAV 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,203 Number of Sequences: 438 Number of extensions: 2070 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10873896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -