BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120474.Seq (819 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 30 2.6 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_29724| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-05) 28 7.9 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 769 SYLFKSLLKP-RCQTRGFSILTIDGLSTEHNSTPSFSVNKMGSPGMLVSLVSVTTNSILL 593 +++ ++LK R T+ F I+ DGLS + TPS ++ +G + + S+ LL Sbjct: 1825 TFVLDNVLKTVRTNTKNFVIIITDGLSQDDVQTPSQALRDVGVTVFSIGVGSLINKEQLL 1884 Query: 592 V 590 + Sbjct: 1885 I 1885 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 274 KCIKMKRVKCNKVR-TVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYM 450 K + KR K++ T E+V +K +K + L + +LK L E Y+ LK K L KY+ Sbjct: 68 KSAEAKRESKKKIKETERELV---QKGKKPFYLRKSELKKLELAEKYKELKSKGKLQKYL 124 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/84 (25%), Positives = 40/84 (47%) Frame = +1 Query: 253 LKANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKL 432 ++A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 978 IQAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEI 1034 Query: 433 ALSKYMAMLSTLEMTQPLLEIFRN 504 S+ +M L Q E RN Sbjct: 1035 LRSEQESMHQVLTERQQECETLRN 1058 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/84 (25%), Positives = 40/84 (47%) Frame = +1 Query: 253 LKANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKL 432 ++A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 926 IQAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEI 982 Query: 433 ALSKYMAMLSTLEMTQPLLEIFRN 504 S+ +M L Q E RN Sbjct: 983 LRSEQESMHQVLTERQQECETLRN 1006 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 712 LTIDGLSTEHNSTPSFSVN-KMGSPGMLVSLVSVTTNSILLVKLV 581 LT++ L + + T + S +G ++VS+ SVTTNS++LV ++ Sbjct: 760 LTVNILQNQGSRTMTSSYYLAIGILSIIVSITSVTTNSLILVVII 804 >SB_29724| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-05) Length = 435 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 436 LSKYMAMLSTLEMTQPLLEIFRNKETLGKLPPWCLAH*LLYTIDSI 573 +S ML+ L T PL+ + ++TLG++P +C L T+ + Sbjct: 87 ISASCLMLTLLSYTVPLISMNATQKTLGEVPLFCYWSALFETLGCV 132 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,429,558 Number of Sequences: 59808 Number of extensions: 423497 Number of successful extensions: 1064 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -