BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120474.Seq (819 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11070.1 68417.m01798 WRKY family transcription factor other ... 31 1.2 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 29 2.8 At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family p... 29 4.9 At4g28760.2 68417.m04113 expressed protein predicted protein. Ar... 29 4.9 At4g28760.1 68417.m04112 expressed protein predicted protein. Ar... 29 4.9 >At4g11070.1 68417.m01798 WRKY family transcription factor other putative proteins, Arabidopsis thaliana Length = 313 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 5/73 (6%) Frame = -3 Query: 808 LRGAKTSWLSARCSYLF----KSLLKPRCQTRGFSILTIDGLSTEHNSTPSFSVNKMGSP 641 L+G+ + LSA SYL ++LL + +IL ++G +T+HN T + + + P Sbjct: 25 LQGSSSPSLSASSSYLTTEIKENLLHNIVSSFKKAILMLNGSTTQHNPTIELAPDPLAHP 84 Query: 640 GMLV-SLVSVTTN 605 G + S S+T N Sbjct: 85 GKVPGSPASITGN 97 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 692 DGAQQHPLVFCKQNGFSGNACVISFSDHKLHFVSKISNKW 573 DG+ PL+ G C++ F D +HF S I+N++ Sbjct: 799 DGSSTSPLLDLFPTSSEG--CILVFDDSDMHFTSSIANRY 836 >At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 Length = 278 Score = 28.7 bits (61), Expect = 4.9 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 5/79 (6%) Frame = +1 Query: 271 DKCIKMKRVKC-NKVRTVTEIVNSDEKIQKTYELAEFDLKNLSS----LESYETLKIKLA 435 D IK K + +K +T+T + S++ I +E +L+N+ L+ Y+ LK++ Sbjct: 42 DLFIKTKLIAAIDKYQTITVLAVSNDAISSITNRSEVELRNILMTHVILDYYDELKLQ-G 100 Query: 436 LSKYMAMLSTLEMTQPLLE 492 + + ML+TL T L E Sbjct: 101 MREKSIMLTTLYQTTGLGE 119 >At4g28760.2 68417.m04113 expressed protein predicted protein. Arabidopsis thaliana Length = 924 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 397 SLESYETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKETLGKL 525 S ES + K LS+ A++S TQPL + R TLG++ Sbjct: 458 SPESSVCREAKKRLSERWALMSVSGRTQPLKHVSRTSSTLGEM 500 >At4g28760.1 68417.m04112 expressed protein predicted protein. Arabidopsis thaliana Length = 924 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 397 SLESYETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKETLGKL 525 S ES + K LS+ A++S TQPL + R TLG++ Sbjct: 458 SPESSVCREAKKRLSERWALMSVSGRTQPLKHVSRTSSTLGEM 500 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,652,854 Number of Sequences: 28952 Number of extensions: 296376 Number of successful extensions: 758 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -