BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120473.Seq (835 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0742 + 35900505-35900519,35901230-35901281,35901647-359017... 33 0.37 06_01_0691 - 5040280-5040801,5041439-5041529,5042368-5042568,504... 31 1.1 08_01_0628 - 5460030-5462960 28 8.0 >03_06_0742 + 35900505-35900519,35901230-35901281,35901647-35901772, 35902303-35902613,35902745-35902988,35903726-35903976, 35904071-35904277,35904546-35904713,35904798-35905127, 35905266-35905400 Length = 612 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +2 Query: 323 KNSYVGVILLGSKNTKNSVAEQAPGEFKHIEL---LSALQTPTWQMIRELPESPSKSK 487 ++ +GV+L G+K T N +A++ G +KH+ + + + T ++ LP S K Sbjct: 10 RSDEIGVVLFGTKETSNELAKEL-GGYKHVVVARDIKVVDEETTNALQNLPRGTSPGK 66 >06_01_0691 - 5040280-5040801,5041439-5041529,5042368-5042568, 5042649-5046148 Length = 1437 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 613 DEIQQVLNGFKADNLEVNVIGPNLYDEGNIKNNDFEL 723 DE ++VLN K+ NLE++ + + + ++N D+ L Sbjct: 1078 DEAEKVLNSLKSSNLEISTLPYSTVLDAYLRNRDYSL 1114 >08_01_0628 - 5460030-5462960 Length = 976 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 368 KNSVAEQAPGEFKHIELLSALQTPTWQMIRELPESPSKSK 487 +++ E+ P + ++ L L T W M+++LP S SK K Sbjct: 647 RSTFIEELPKDLGKLQKLQTLDTK-WSMVQKLPSSLSKLK 685 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,193,007 Number of Sequences: 37544 Number of extensions: 347130 Number of successful extensions: 666 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -