BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120473.Seq (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 26 0.49 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 26 0.49 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.1 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 25.8 bits (54), Expect = 0.49 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +1 Query: 598 TKYDHDEIQQVLNGFKADNLEVNVI---GPNLYDEGNIKNN 711 TKYD+ +I VLN + N VN + GP D +K N Sbjct: 26 TKYDNVDIDVVLNTERLLNAYVNCLLDQGPCTPDAAELKRN 66 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 25.8 bits (54), Expect = 0.49 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +1 Query: 598 TKYDHDEIQQVLNGFKADNLEVNVI---GPNLYDEGNIKNN 711 TKYD+ +I VLN + N VN + GP D +K N Sbjct: 26 TKYDNVDIDVVLNTERLLNAYVNCLLDQGPCTPDAAELKRN 66 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 631 LNGFKADNLEVNVIGPNL 684 +N K DN++VNV G N+ Sbjct: 174 INFDKYDNIQVNVSGDNV 191 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,026 Number of Sequences: 438 Number of extensions: 4114 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -