BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120470.Seq (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48253| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) 33 0.32 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) 31 0.96 SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) 31 1.3 SB_12983| Best HMM Match : Moricin (HMM E-Value=7) 30 2.2 SB_5860| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.8 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 29 3.9 SB_37232| Best HMM Match : EGF (HMM E-Value=1) 29 3.9 SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) 29 5.1 SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_48253| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) Length = 156 Score = 32.7 bits (71), Expect = 0.32 Identities = 23/65 (35%), Positives = 31/65 (47%) Frame = +2 Query: 245 GNH*TDRNLPLNTECNVKAVDSACMRCRRSFAVYPAVTYLHCGHSCLCTDCDETVNVDNT 424 GNH R P+ CN + C + R S V +CGHSC C+ C + VN Sbjct: 11 GNH---RLTPIG--CNFGGQE-ICDQYRTSKMKLVPVVMPNCGHSC-CSTCAKRVN--RK 61 Query: 425 CPKCK 439 CP+C+ Sbjct: 62 CPECR 66 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 31.1 bits (67), Expect = 0.96 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 353 VTYLHCGHSCLCTDCDETVNVDNTCPKCKSGI 448 V L+CGH C C C + + + CP C+ I Sbjct: 548 VVLLNCGHVCSCRTCAQQI---HQCPVCRGDI 576 >SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) Length = 317 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 299 AVDSACMRCRRSFAVYPAVTYLHCG-HSCLCTDCDETVNVDN 421 A + C C+ F+ + Y G H C+C +C+ET + +N Sbjct: 225 ATKNKCASCQTEFSRSKDLKYHEKGCHPCVCNECNETFDHEN 266 >SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30) Length = 514 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +2 Query: 323 CRRSFAVYPAVTYLHCGHSCLCTDCDETVNVDNTCPKCKSGIR 451 C+ + +L CGH C C E + + CP C++ IR Sbjct: 473 CKICMDAEVGIVFLPCGHLSCCPGCAEGMEL---CPMCRAPIR 512 >SB_12983| Best HMM Match : Moricin (HMM E-Value=7) Length = 150 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 605 ERIKRLARDNNDDDDSYFYHK 667 E +K++ARD D+ SYF+H+ Sbjct: 49 ETLKKVARDKEDEKSSYFHHQ 69 >SB_5860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 25.4 bits (53), Expect(2) = 2.8 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +2 Query: 629 DNNDDDDSYFYH 664 D++DDDD Y+YH Sbjct: 36 DDDDDDDVYWYH 47 Score = 23.0 bits (47), Expect(2) = 2.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 599 VNERIKRLARDNNDDDD 649 ++E + L DN+DDDD Sbjct: 7 ISETLLHLDNDNDDDDD 23 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 4 VRTLFVETKNYQR--NFDSNLPQ-PPRSTTCTTVALRRKRFEFWLARYLRC 147 VRT+ E NY++ +FD N+P P + +++ F W +L+C Sbjct: 338 VRTMASEPSNYRKSADFDFNMPDTDPTAADAEWKKIQQNTFTRWCNEHLKC 388 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +3 Query: 306 TVHACVAEEVSQFTPPLPICIADIRVCAPIATKR*TWTIRV 428 +VH C A V++FT L +C+ + CA + R T +R+ Sbjct: 411 SVHTCAALVVARFTLVLRLCL-PVHTCAALVFARFTLALRL 450 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 362 LHCGHSCLCTDCDETVNVDNTCPKCKSGIR 451 L C H+C+C C +++ CP C+ IR Sbjct: 701 LPCRHACVCGSCFS--RLESKCPLCRQVIR 728 >SB_37232| Best HMM Match : EGF (HMM E-Value=1) Length = 79 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 368 CGHSCLCTDCDETVNVDNTCPKCKSGIRYKLK 463 C + C + + VN TCP C G+R ++K Sbjct: 3 CANGGTCNNGADNVNNTCTCPVCLKGVRCEMK 34 >SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) Length = 464 Score = 28.7 bits (61), Expect = 5.1 Identities = 22/82 (26%), Positives = 29/82 (35%) Frame = +1 Query: 79 TTCTTVALRRKRFEFWLARYLRCTTRPSIGTAARCSRCGATTDV*LTLRAFATKRWKSLD 258 T C R+RF +L C P A CG TLR+ TK W ++ Sbjct: 121 TICNETKELRRRFNLTCGEFLLCAGVPIF--PAHNLNCGVNVT---TLRSLYTKSWSNVP 175 Query: 259 RQKLAAQHRMQCEGCRQCMHAL 324 Q + A E C + L Sbjct: 176 EQFIKAYSASFKETIVLCRYGL 197 >SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 631 Score = 27.9 bits (59), Expect = 9.0 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +2 Query: 218 LCGHSQQ-NAGNH*TDRNLPLNTECNVKAVDSACMRCRRSFAVYPAVTYLHCGHSCLCTD 394 +C + + +AGNH +N +CN CM C F+ G CTD Sbjct: 152 MCSETDECSAGNHTCGKN----AKCNNTIGSYHCM-CNPGFS----------GDGRECTD 196 Query: 395 CDETVNVDNTCPK 433 DE V D+TC K Sbjct: 197 IDECVTGDHTCDK 209 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,926,036 Number of Sequences: 59808 Number of extensions: 451073 Number of successful extensions: 1564 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -