BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120469.Seq (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 22 4.8 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 22 4.8 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 22 6.4 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 777 DIANDCDVWSDSSVSRSGQRLVLGNGGQGGAMASRSASS 661 ++A W D S L LG+ G+G A+A + +S Sbjct: 240 NVAAGIQYWLDEGAPPSKINLGLGSYGRGFALADPTNTS 278 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 777 DIANDCDVWSDSSVSRSGQRLVLGNGGQGGAMASRSASS 661 ++A W D S L LG+ G+G A+A + +S Sbjct: 240 NVAAGIQYWLDEGAPPSKINLGLGSYGRGFALADPTNTS 278 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 777 DIANDCDVWSDSSVSRSGQRLVLGNGGQGGAMASRSASS 661 ++A W D S L LG G+G A+A + +S Sbjct: 239 NVAAGIQYWLDEGAPPSKINLGLGTYGRGFALADPTNTS 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,711 Number of Sequences: 336 Number of extensions: 3507 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -