BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120469.Seq (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20340.1 68418.m02420 beta-1,3-glucanase (BG5) identical to p... 32 0.50 At1g12080.2 68414.m01397 expressed protein 31 0.66 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 31 1.1 At1g06530.1 68414.m00692 myosin heavy chain-related similar to m... 30 1.5 At5g20330.1 68418.m02419 beta-1,3-glucanase (BG4) identical to t... 29 2.6 At1g34320.1 68414.m04259 expressed protein contains Pfam domain ... 29 3.5 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 29 3.5 At4g10270.1 68417.m01688 wound-responsive family protein similar... 29 4.6 At5g42250.1 68418.m05143 alcohol dehydrogenase, putative similar... 28 6.1 At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domai... 28 6.1 At1g64790.1 68414.m07346 translational activator family protein ... 28 6.1 At5g59810.1 68418.m07499 subtilase family protein subtilisin-lik... 28 8.1 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 28 8.1 At5g12220.1 68418.m01434 las1-like family protein similar to Las... 28 8.1 At2g42340.1 68415.m05240 expressed protein 28 8.1 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 28 8.1 At1g61850.1 68414.m06979 patatin family protein similar to membr... 28 8.1 At1g30760.1 68414.m03761 FAD-binding domain-containing protein s... 28 8.1 >At5g20340.1 68418.m02420 beta-1,3-glucanase (BG5) identical to plant beta-1,3-glucanase bg5 GI:2808439 [Arabidopsis thaliana] Length = 354 Score = 31.9 bits (69), Expect = 0.50 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -1 Query: 467 LVYGCFGHGICKSSHAI-LYRLIDLAFFDVFQTLIDVLGDLFPHRDAKFTF*VRALTDLA 291 L YG G + S I LY+ ID+ +F +VL L HRD T VR A Sbjct: 45 LNYGLLGDNLPSPSKVITLYKSIDITKIRIFDPNTEVLNALRGHRDIAVTVGVRDQDLAA 104 Query: 290 LQYSSQS 270 L S ++ Sbjct: 105 LSASEEA 111 >At1g12080.2 68414.m01397 expressed protein Length = 138 Score = 31.5 bits (68), Expect = 0.66 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 378 KNVKESQVYQSIENRVAALTNAVTETPIYQKTESVIKTTAEK 503 + V E++V Q E V A+T +E PI + E V+ AEK Sbjct: 26 ETVVETEVTQQPEESVPAVTEQKSEAPIVETNEEVVVEEAEK 67 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 4/126 (3%) Frame = +2 Query: 362 RQSGFEKRQRKPSLSIDRESRGCSYKCRDRNTHIPKN*ICDKNDRREDVSIIGGITAGVS 541 ++S KR+++ S E R C Y+ D + N D +D+R+ +I I S Sbjct: 148 QKSSVSKRKKENGDS-SGELRSCKYQKSDDKSVATNNEGDDDDDKRK---LIRQIRNRES 203 Query: 542 SKLGQMRNSESFRSIEERVGS---AYENVKGKVASRSNSTQSFDEALRDAM-APPCPPFP 709 ++L ++R + +E +V S + GK+A + + + A APP P+ Sbjct: 204 AQLSRLRKKQQTEELERKVKSMNATIAELNGKIAYVMAENVALRQQMAVASGAPPMNPYM 263 Query: 710 STSRCP 727 + P Sbjct: 264 AAPPLP 269 >At1g06530.1 68414.m00692 myosin heavy chain-related similar to myosin heavy chain (GI:1408194) {Placopecten magellanicus}; similar to Myosin heavy chain, clone 203 (Fragment) (SP:P39922){Hydra attenuata}; contains one transmembrane domain Length = 323 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +3 Query: 255 EDEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNVKESQVYQSIENR 422 E E+A LRTV + ++ +L+ KLG KE+ E + K E ++ + I+N+ Sbjct: 150 EKEVAGLRTVKEENEKRMKELESKLGALEVKELDE---KNKKFRAEEEMREKIDNK 202 >At5g20330.1 68418.m02419 beta-1,3-glucanase (BG4) identical to to plant beta-1,3-glucanase bg4 GI:2808438 from [Arabidopsis thaliana] Length = 345 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -1 Query: 467 LVYGCFGHGICKSSHAI-LYRLIDLAFFDVFQTLIDVLGDLFPHRDAKFTF*VRALTDLA 291 L YG G + S+ I LY+ I ++ +F +VL L HRD + T V+ DLA Sbjct: 36 LNYGLLGDNLPSPSNVINLYKSIGISRIRIFDPNTEVLNALRGHRDIEVTVGVKD-QDLA 94 Query: 290 LQYSSQ 273 +S+ Sbjct: 95 ALAASE 100 >At1g34320.1 68414.m04259 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 657 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +3 Query: 258 DEIATLRTVLQSKIRQSSDLKRKLGITVWKEITEDVNQGLKNV 386 D +A LRT L+S+ + +LK+K ++W I E+V + L +V Sbjct: 310 DTLAILRTELKSQKKHVRNLKKK---SLWSRILEEVMEKLVDV 349 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 74 HSFHTVRVFHCKI*AVFKQLKKQCQ 148 H TV VF+C I V K+LKKQ Q Sbjct: 885 HPNSTVGVFYCGIQTVAKELKKQAQ 909 >At4g10270.1 68417.m01688 wound-responsive family protein similar to wound induced protein (GI:19320) [Lycopersicon esculentum] Length = 90 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 315 LKRKLGITVWKEITEDVNQGLK-NVKE-SQVYQSIENRVAALTNAVTETPIYQKTESVIK 488 LK +LG+ W I VNQ L+ NV+ SQ + + V+A + E+ +K E ++ Sbjct: 20 LKDQLGLCRWNYILRSVNQHLRNNVRSVSQGKRFSSSSVSAAVTSSGESEKAKKAEESLR 79 Query: 489 T 491 T Sbjct: 80 T 80 >At5g42250.1 68418.m05143 alcohol dehydrogenase, putative similar to alcohol dehydrogenase ADH GI:7705214 from [Lycopersicon esculentum]; contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 390 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 755 CGVTAQCPAQGSGLCSGMGGKVAPW 681 CG C + S LCS KV+PW Sbjct: 108 CGDCVDCKSHKSNLCSKFPFKVSPW 132 >At4g31390.1 68417.m04452 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 682 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 563 NSESFRSIEERVGSAYENVKGKVASRSNSTQSFDEALR 676 N +F IEE +G EN+ K++S++ + S + R Sbjct: 215 NEVAFNIIEEELGQPLENIFSKISSQTIAAASLGQVYR 252 >At1g64790.1 68414.m07346 translational activator family protein similar to HsGCN1 [Homo sapiens] GI:2282576 Length = 2440 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/72 (23%), Positives = 34/72 (47%) Frame = -1 Query: 371 LIDVLGDLFPHRDAKFTF*VRALTDLALQYSSQSRDFIFTRASSRLHSARNWSACSGVRP 192 + D+L DL H D + ++ + QY ++ + + + L +++NW A G Sbjct: 2204 IFDLLKDLMHHEDDQVRISATSMLGVLSQYLEAAQLSVLLQEVNDLSASQNWGARHGSVL 2263 Query: 191 ANSSGVCMSPAT 156 SS + +P+T Sbjct: 2264 CISSLLKHNPST 2275 >At5g59810.1 68418.m07499 subtilase family protein subtilisin-like protease AIR3, Arabidopsis thaliana, EMBL:AF098632 Length = 778 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 752 GVTAQCPAQGSGLCSGMGGKVAPW 681 GVT C A SG SG VAPW Sbjct: 327 GVTVVCSAGNSGPKSGTVSNVAPW 350 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 27.9 bits (59), Expect = 8.1 Identities = 28/117 (23%), Positives = 47/117 (40%), Gaps = 2/117 (1%) Frame = +2 Query: 380 KRQRKPSLSIDRESRGCSYKCRDRNTHIPKN*ICDKNDRREDVSIIGGITAGVSSKLG-- 553 KR +K + DR+ ++ + N+H+P N + G +T SSK+ Sbjct: 235 KRIKKEAGGSDRKGEDTVHRDKSNNSHVPGGRTASGNS--DSKKSKGLLTEKTSSKVSAD 292 Query: 554 QMRNSESFRSIEERVGSAYENVKGKVASRSNSTQSFDEALRDAMAPPCPPFPSTSRC 724 + NS + E+ +GK+A R DE+ R A P C + +C Sbjct: 293 KHENSPGIKVGVSGKKRRLESEQGKLAPR------VDESSRAAKKPRCESADNKVKC 343 >At5g12220.1 68418.m01434 las1-like family protein similar to Las1p [Saccharomyces cerevisiae] GI:495504; contains Pfam profile PF04031: Las1-like Length = 611 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 470 N*ICDKNDRREDVSIIGGITA-GVSSKLGQMRNSESFRSI 586 N + +K RREDVSI A G+ KL +R+ S R + Sbjct: 119 NCVIEKTRRREDVSIADAARAIGIPRKLIDLRHEGSHREL 158 >At2g42340.1 68415.m05240 expressed protein Length = 349 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +2 Query: 575 FRSIEERVGSAYENVKGKVASRSNSTQSFDEALRDA-MAPPCPPFPSTSRCPERDTELSL 751 F+S+EE V EN+ + ++ +S +A +A PP PP PS + + T + Sbjct: 38 FKSLEEVVSKLTENLNLTESQIASIWKSLIKAEEEAQQVPPPPPPPSAADVSSKSTRKKM 97 Query: 752 HTSQS 766 S Sbjct: 98 KKQAS 102 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 312 DLKRKLGITVWKEITEDVNQGLKNVKESQVYQSIENRVAALTNAVTETP-IYQKTESVIK 488 D + + G K T+DV + ++ +KE ++Y+ +T V ET Y+K E K Sbjct: 831 DCEEEEGSEESKIKTDDVVRKVQGIKEEELYKPKREHGTKITELVEETTGDYEKQEE--K 888 Query: 489 TTAE 500 TAE Sbjct: 889 ETAE 892 >At1g61850.1 68414.m06979 patatin family protein similar to membrane-associated calcium-independent phospholipase A2 gamma; IPLA2 gamma [Homo sapiens] GI:8453174; contains Patatin domain PF01734, PF00514: Armadillo/beta-catenin-like repeat Length = 1265 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 220 LRAEWSRELARVKMKSRL*ELYCKARSVKART*NVNLASRCGKRSPRTS 366 + A+ S + RVK +R E +C +K + + C K SP T+ Sbjct: 859 MEAQHSPDSGRVKYHARALESFCSNNGIKLSSLHTTATPGCQKPSPGTA 907 >At1g30760.1 68414.m03761 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 534 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 712 AREWGARWRHGVTQRLVEALSRVRSRSYF 626 AREWG R+ G +RLVE ++ ++F Sbjct: 495 AREWGNRYFKGNFERLVEIKAKFDPENFF 523 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,153,134 Number of Sequences: 28952 Number of extensions: 323478 Number of successful extensions: 1181 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -