BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120468.Seq (821 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 5.1 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 5.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.8 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 6.8 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 6.8 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 6.8 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 6.8 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 414 CITYREFDTL*LELSNFVFG 355 C+TY F T EL+ +FG Sbjct: 204 CVTYNVFPTYAHELTYLLFG 223 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 414 CITYREFDTL*LELSNFVFG 355 C+TY F T EL+ +FG Sbjct: 204 CVTYNVFPTYAHELTYLLFG 223 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 403 ICYTMKKCLLAPKSYLSRRLQSIIK 477 +C T KK L+P + L ++ I+K Sbjct: 1364 LCCTKKKEELSPNALLDKQAVEIVK 1388 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 403 ICYTMKKCLLAPKSYLSRRLQSIIK 477 +C T KK L+P + L ++ I+K Sbjct: 1364 LCCTKKKEELSPNALLDKQAVEIVK 1388 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 403 ICYTMKKCLLAPKSYLSRRLQSIIK 477 +C T KK L+P + L ++ I+K Sbjct: 1364 LCCTKKKEELSPNALLDKQAVEIVK 1388 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 403 ICYTMKKCLLAPKSYLSRRLQSIIK 477 +C T KK L+P + L ++ I+K Sbjct: 1364 LCCTKKKEELSPNALLDKQAVEIVK 1388 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.8 bits (44), Expect = 6.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 469 YFVNASTNNFLARGGIFSLYNISGI*YIVIRIK 371 Y VNASTN FL I GI Y + ++K Sbjct: 268 YTVNASTNIFLCDEICNEGQTILGISYSLEKLK 300 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 6.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 469 YFVNASTNNFLARGGIFSLYNISGI*YIVIRIK 371 Y VNASTN FL I GI Y + ++K Sbjct: 268 YTVNASTNIFLCDEICNEGQTILGISYSLEKLK 300 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 108 IIKTLCVCVFYLSHKMDVWQKSQPILVFFS 19 I++T+C+C+F K++ + +QP+LV S Sbjct: 330 IVRTVCLCLF--GGKVND-ESTQPMLVLNS 356 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 108 IIKTLCVCVFYLSHKMDVWQKSQPILVFFS 19 I++T+C+C+F K++ + +QP+LV S Sbjct: 330 IVRTVCLCLF--GGKVND-ESTQPMLVLNS 356 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,209 Number of Sequences: 336 Number of extensions: 3051 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22517873 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -