BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120466.Seq (808 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac... 26 7.2 >SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosaccharomyces pombe|chr 2|||Manual Length = 290 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 786 LGVDLYSYVFSKISAITRLLSKVKNKYVSPSLKLTQKN 673 L VD Y+ AI+ L S++ +KY SP + N Sbjct: 22 LAVDCYADWCGPCKAISPLFSQLASKYASPKFVFAKVN 59 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,615,010 Number of Sequences: 5004 Number of extensions: 46089 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -