BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120464.Seq (828 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0516 + 25833801-25834046,25834412-25834532,25834636-258348... 29 3.4 >04_04_0516 + 25833801-25834046,25834412-25834532,25834636-25834821, 25834918-25834944,25836203-25836351,25836553-25836602, 25837181-25837289,25837395-25837532,25838184-25838463, 25838533-25838656,25838994-25839003 Length = 479 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 748 FRARYNLFNRTLNLFYSWSR---THIGHSRYKITGNHYTT 638 F + + LF L Y W H+GHSR+ + NH T Sbjct: 396 FVSFFLLFGSYLRFVYRWGSLDANHVGHSRFDSSENHMVT 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,131,838 Number of Sequences: 37544 Number of extensions: 338797 Number of successful extensions: 594 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -