BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120464.Seq (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_53809| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-23) 30 2.0 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -3 Query: 814 LNTNRAEHRKPNKAWFCTVTSMFRARYNLFNRTLNLF 704 ++ N+ HR+ ++A TVT ++RARYN R+ + F Sbjct: 491 IHENKTCHRRFDRARPGTVTQVYRARYNFLVRSFSRF 527 >SB_53809| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-23) Length = 486 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -3 Query: 793 HRKPNKAWFCTVTSMFRARYNLFNRTLNLFYSWSRTHIGHSR--YKITGNHYTTLT 632 H + NK V ++ +ARYN + T L ++W THI R + G H TT T Sbjct: 97 HTRYNK--HIKVRTVQQARYNTHSATRTLRHAWYSTHIAVRRVQHAHCGTHGTTRT 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,322,816 Number of Sequences: 59808 Number of extensions: 437162 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -